KEGG   Bacillus safensis: BSL056_16120Help
Entry
BSL056_16120      CDS       T05386                                 

Definition
(GenBank) ubiquitin
Organism
bsaf  Bacillus safensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YukD
Motif
Other DBs
NCBI-ProteinID: APJ12385
UniProt: A0A0M2EGW0
LinkDB All DBs
Position
complement(3101239..3101478)
Genome map
AA seq 79 aa AA seqDB search
MYIDITIDLKNYDGSVFDLRLSNYLHIKQVIHIAWQAKQISLPKREGGWVRVVNKKAVFS
GEYKLSDCGITTGDRLEIL
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
gtgtatatcgatattaccatcgacttaaaaaattatgatggcagtgtgtttgatttgaga
ctatcaaattatttacatattaaacaagtcatccatatcgcctggcaggcaaaacaaatc
tcacttccaaagcgagaaggcggatgggtgcgggtagtcaataagaaagctgtgttttca
ggcgaatataagctgtcagactgtggaattaccacaggagacaggctggaaatactatga

DBGET integrated database retrieval system