KEGG   Bacillus safensis: BSL056_18725
Entry
BSL056_18725      CDS       T05386                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00998  Biosynthesis of various secondary metabolites - part 2
bsaf01100  Metabolic pathways
bsaf01110  Biosynthesis of secondary metabolites
Module
bsaf_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSL056_18725
Enzymes [BR:bsaf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BSL056_18725
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-ProteinID: APJ13328
LinkDB
Position
3616508..3617701
AA seq 397 aa
MEILPSNMIKRLPEQKFGTVFEKIAQKAQNGANIINLGQGNPDLPTPAHIVSALQEAAAT
LQFQQYAPFRGFDFFKQAIADFYKKEFGTEIDPQKEVALFNGGKTGLYVMSQCLLDPGDV
ALIPDPGYPEYHSGILMADAKPYCIKLESKNGYLPNLSSIDPEVLKKAKVLFLNYPNNPT
GAVANDAFFEEAADFASAHGLHVIHDFAYGSFHYEQKPVSFLNAPLGKSVGVELYSLSKT
FNIAGWRVAFAVGNEDIIQAINAFQDHVFVSMYGGFQQAATVALQSDDSHIQSLKEVYLE
RIHFFIRQAEKELGWSIERPAGAFYLWAPIPDDFEHSHAFADYLLEHTDVVVTPGGVFGA
HGSRHVRISMVAPIEQLALFIDRLRILPIRFNQKTRI
NT seq 1194 nt   +upstreamnt  +downstreamnt
gtggagatcttaccatctaacatgattaaacggctgccagaacagaaatttggaaccgta
tttgagaaaattgcacaaaaagcacaaaacggagcgaacatcataaaccttggtcaggga
aatcccgatcttcctactcctgcacatatcgtaagcgcccttcaagaagcagcagccact
ttgcaatttcagcaatatgcaccttttagaggcttcgactttttcaagcaagccattgca
gatttctacaaaaaggagttcggcactgagatagacccacagaaagaagttgctcttttc
aatggagggaaaacaggcctttatgtcatgagtcagtgtctgcttgaccctggggacgtt
gccctcatccccgatccaggatacccagaatatcattctgggatcttgatggcagacgct
aagccctactgcatcaaacttgaatcgaaaaatggctatttgccaaatctctcttcaatt
gatccggaggtgcttaaaaaggcaaaggttcttttcttaaattatccgaataacccaaca
ggtgctgtggcaaatgatgcattttttgaagaggctgctgattttgcatcggctcacgga
ctgcatgtcattcatgattttgcctatggttcatttcattatgagcaaaaaccagtaagc
tttctgaacgctcctcttgggaaaagcgtaggagtggaattatattctctatccaaaaca
tttaatatagcaggatggagagtcgcttttgctgtaggtaatgaggacatcatccaagcc
attaacgccttccaagatcatgtgtttgtcagtatgtatggcggatttcaacaagcagca
accgtcgccttgcaaagtgatgacagtcacatacaatcattaaaagaggtctaccttgaa
cgaattcacttcttcatccgtcaggccgaaaaggagctaggatggtccatcgaacgtcca
gctggcgccttttatttatgggctcccatccctgatgattttgaacattctcatgcattt
gctgactatttactcgaacatactgatgttgttgtcacgccggggggtgtgtttggagca
catggaagtcgtcatgtccgcatctcaatggttgctccaattgaacagcttgccctgttt
atcgaccggcttcgcatccttccaattcgctttaatcaaaaaacccgcatatag

DBGET integrated database retrieval system