KEGG   Bacterioplanes sanyensis: CHH28_01260Help
Entry
CHH28_01260       CDS       T04982                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bsan  Bacterioplanes sanyensis
Brite
Enzymes [BR:bsan01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CHH28_01260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASP37391
UniProt: A0A222FG53
LinkDB All DBs
Position
268149..268733
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYEKDALQPHISQETLEFHYGKHHNTYVQKLNGLIEGTEFADKSLEEIVKTS
SGGVFNNAAQIWNHTFYWHSLSPNGGGEPTGAIADAINAAFGSFADFQAKFNDMAVNNFG
SSWTWLVKKADGTLDIVNTSNAATPLTEEGLTPLLTVDLWEHAYYIDYRNVRPDYLKGFW
ALVNWEFANQNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgaattaccggccctgccttacgaaaaagatgctctgcagccacacatctct
caggagactctggagttccattacggcaagcaccacaacacctacgttcagaaactgaac
ggtctgatcgaaggcactgaattcgccgacaagtctctggaagagatcgtaaaaacctct
tctggcggcgtattcaacaatgcggcacaaatctggaaccacaccttctactggcacagc
ctgagcccgaacggtggtggtgagccaacgggcgctattgccgacgccatcaacgcagca
tttggttcgttcgctgacttccaagccaagttcaacgacatggctgtgaataacttcggc
tctagctggacttggttggtgaaaaaagccgacggcactctggacatcgttaacacttct
aacgctgccacgccgctgacggaagaaggcctgacgccactgctgaccgttgatctgtgg
gaacacgcctactacatcgactaccgcaacgttcgccctgactacctgaaaggtttctgg
gcactggttaactgggaatttgctaaccagaacctggctgcttaa

DBGET integrated database retrieval system