KEGG   Bacterioplanes sanyensis: CHH28_07865Help
Entry
CHH28_07865       CDS       T04982                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
bsan  Bacterioplanes sanyensis
Pathway
bsan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsan01100  Metabolic pathways
bsan01110  Biosynthesis of secondary metabolites
bsan01130  Biosynthesis of antibiotics
bsan01230  Biosynthesis of amino acids
bsan02024  Quorum sensing
Module
bsan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHH28_07865
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CHH28_07865
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CHH28_07865
Enzymes [BR:bsan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CHH28_07865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ASP38596
UniProt: A0A222FJ28
LinkDB All DBs
Position
1647545..1648129
Genome map
AA seq 194 aa AA seqDB search
MLLMIDNYDSFTYNVVQYFAELGADVKVVRNDEVSVQQIEALQPDQLVISPGPCTPNEAG
ISMAAIEHFAGKLPILGICLGHQSIGQVFGGHVVRAGQVMHGKTSAVYHKNSGVFRGLKN
PYRATRYHSLVVDKDRLPDCLEVTAWTQNDDGSVEEIMGIRHKTLAIEGVQFHPESILTE
HGHDLLKNFLDAHR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgatgattgataactacgactcgtttacttacaacgtcgtgcagtactttgct
gaactgggtgccgacgtcaaagtcgtgcgcaatgatgaagtcagcgtgcagcaaattgaa
gcgctacaacccgatcagctggtgatttctcccggcccttgtacgccgaatgaggcgggc
atatccatggctgcgattgaacacttcgctgggaaattgcccattttggggatttgtttg
gggcaccagagcatcggccaagtgtttggtggccatgtggtgcgtgcggggcaagtcatg
cacggcaaaacctctgcggtttatcacaaaaacagcggcgtgtttcgcggtttaaagaat
ccgtatcgtgcaacccgataccactcgctggtcgtggacaaagatcgtttgcccgactgc
ctagaagtgactgcttggacacaaaatgacgacggcagtgtcgaagaaatcatggggatt
cgacacaaaacattggccattgaaggcgtacagttccacccagaatccatactgaccgag
catggtcacgacttattaaaaaattttttagacgctcaccggtga

DBGET integrated database retrieval system