KEGG   Bacterioplanes sanyensis: CHH28_14740Help
Entry
CHH28_14740       CDS       T04982                                 

Definition
(GenBank) multidrug ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsan  Bacterioplanes sanyensis
Brite
KEGG Orthology (KO) [BR:bsan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsan02000]
    CHH28_14740
Transporters [BR:bsan02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    CHH28_14740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_30 IstB_IS21 AAA_16 AAA_29 AAA_22 cobW AAA_15 RsgA_GTPase MMR_HSR1 AAA_33 TsaE
Motif
Other DBs
NCBI-ProteinID: ASP39854
UniProt: A0A222FMV6
LinkDB All DBs
Position
complement(3187051..3187911)
Genome map
AA seq 286 aa AA seqDB search
MNALVQATQLRKSFGKSSVLNGIDLTIEAGQIVGLIGPNGAGKTTLLRCLLGLTEADGEL
SVLGQSPWQQREKMLQQLAYIPDTAILPRWISVEKLLTYMQGVHPRFDPERARSLLDTTD
VPMNKKIGQLSKGMVTQVHLALVMAIDAQLLVLDEPTLGLDILYRRQFYQRLLEDYYDQE
RTIIITTHQVDEIEDILTHAAFVRRGELVLQSSIEDLQDNFRQLTVKPAQLEAARALNPV
SEQTLLGASRLLMQNCDESQLQALGDVGLASLSDVFVALMQQEYEK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactcgtgcaagcgacgcagttgcgtaaatccttcggtaaaagttctgtactc
aatggcatcgatttgaccatcgaagctggacaaattgtcggtttaatcggcccgaatggc
gctggtaaaaccaccttgttgcgttgtttgttggggctaaccgaggccgatggagagctg
tccgtgctcggacaatcgccgtggcagcaacgagaaaaaatgctgcagcagctggcgtac
attccagatactgccattttgccacgctggatttcagtagaaaaattgctgacctatatg
cagggtgtgcatccgcgttttgatcctgagcgcgcgcgctcattgttggacaccactgac
gtgccgatgaataaaaaaatcggccaattaagtaaaggcatggtgacccaggtgcacctg
gcactggtgatggcgattgatgctcagctgctggtgttggatgagccaacgttggggctg
gatattctctatcgacgccagttttatcaacggctgctggaagattattacgaccaagag
cggaccatcatcatcaccacccaccaggtcgatgaaatcgaagacattctgacacacgcc
gcgtttgtgcgccgtggcgagttggtattgcagtcatcaatagaagacttgcaggacaac
ttccgccagctgaccgtcaaaccagcacagttagaagccgcacgcgcactcaatccggta
tctgagcaaaccttgttaggggcgtcgcgtttgttaatgcaaaactgtgatgagtcacag
ttgcaagcgctgggagacgttgggttggccagtttgagcgatgtgtttgtcgccttgatg
caacaggagtacgaaaaatga

DBGET integrated database retrieval system