KEGG   Bacterioplanes sanyensis: CHH28_16315Help
Entry
CHH28_16315       CDS       T04982                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bsan  Bacterioplanes sanyensis
Pathway
bsan00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bsan00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CHH28_16315
Enzymes [BR:bsan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CHH28_16315
Transporters [BR:bsan02000]
 Other Transporters
  Pores ion channels [TC:1]
   CHH28_16315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: ASP40142
UniProt: A0A222FN83
LinkDB All DBs
Position
3552981..3553649
Genome map
AA seq 222 aa AA seqDB search
MIVLHHLEHSRSQRILWLLEELGVEYEIKRYQRNKDTYLAPESLKQVHPLGKSPVITDGE
QTIAESGLIVEYLIRRYGRERFMPEENSDDYWQYLYWMHYAEGSLMPLMVMSLIFTRIET
APMPFFVKPIAKGIVGKVRAGFIHPNVDTHMQHIEQHLATHHWFVGEQLSGADIQMIFPL
EAALNRGVKAENYPNIQRFVHQVHQLDSYKTALQKGGPYAYA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcttgcaccaccttgaacactcacgctcacaacgcattctctggttgctagaa
gagctgggcgtggaatacgaaatcaaacgctaccagcgcaataaagacacctatttagcg
ccagagagcctgaaacaagtccaccctctcggtaaatcaccggtaattaccgacggcgag
caaaccattgcggaatccggtttaattgtcgaatacctgattcgtcgctacggccgcgag
cgttttatgccagaagaaaacagtgacgattattggcagtatttatactggatgcactac
gccgaaggcagcctgatgcccttgatggtgatgtcgctgattttcactcgcatcgaaaca
gcgccaatgccattttttgtcaaacccatagccaaaggcattgtcggcaaagtgcgcgcc
ggttttattcatcccaatgtcgatacgcatatgcagcacatcgaacagcacctggccaca
catcattggtttgtcggcgagcagctcagcggtgcggatattcaaatgattttcccactg
gaagcggcgctcaaccgcggcgtgaaagcggagaactatcctaatatccaacgttttgtt
caccaagtacaccaactggacagctataaaaccgcgctgcaaaaaggtgggccctacgca
tacgcctaa

DBGET integrated database retrieval system