KEGG   Brachybacterium saurashtrense: DWV08_16040Help
Entry
DWV08_16040       CDS       T05573                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
bsau  Brachybacterium saurashtrense
Pathway
bsau00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bsau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DWV08_16040
Enzymes [BR:bsau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     DWV08_16040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AXK46982
UniProt: A0A345YST0
LinkDB All DBs
Position
3570768..3572777
Genome map
AA seq 669 aa AA seqDB search
MTAARPWPLGIEGIAYGGDYNPEQWPREVRLEDIALMREAGVTLLSVGIFSWAALEPREG
EYEFEWLDEVLDLLAEAGIRVALATATASPPPWLTHQHPELLPVTAEGTVLSPGGRQAYA
VSSPVFRDYAVRMTRVMAERYAEHPALALWHVDNELGCHVPHDFSDHAAAAFRRWLERRY
GTIEALNEAWGTAFWSQRYSDFAQILPPRAAPTYPNPTQQLDFARYSSDELLAHYRALRE
VLAEVTPHVPATTNFMLSSATKWMDYFSWAEDVDVVANDHYLIAADPRGQIELAFAADLS
RGVAGGDPWILMEHSTSAVNWQSRNRAKGPGEMLRNSLSHLARGADGIMFFQWRQSRAGA
EKFHSAMVPHAGTESEVWRGTVALGRALEALAPVRGSRVLNRVALVMDYPSWWASELDSH
PTQALRYSEEMLRWYTALWDLGVGVDVVGVGADLTGYELVIAPTLYSVSEAQAAGAAEAA
RAGAQVVITFFSGIVDEHDQVHLGGYPGAFRDLLGVRSEEFHPLLEGEVHHLDDGTAADL
WSERTHLEGAEAVRRWADGPLHGLPAVTRNPVGEGAAWYVAARPSAEGLGALVAEIVAAA
GVEPAVAGLHRDVEAVRRFAEDGTTYLFVLNHSERDQVVQVSGEELLRGTVADGALTVHA
GAVAVIRER
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgcacgaccctggccgctcggcatcgaggggatcgcctacggcggcgactac
aaccccgagcaatggccccgcgaggtgcgcctggaggacatcgcgttgatgcgcgaggcc
ggcgtgaccctgctcagcgtgggcatcttctcctgggccgcgctggagccgcgcgagggc
gagtacgagttcgagtggctggacgaggtgctggacctcctcgccgaggccgggatccgg
gtcgcgctcgccaccgccacggcctccccgccgccgtggctcacgcatcagcatcccgag
ctgttgccggtcaccgccgagggcacggtgctgagtcccgggggtcggcaggcctacgcc
gtctcctcgcccgtgttccgcgactacgcggtgcggatgacccgcgtgatggccgagcgc
tacgccgagcaccccgcgctcgccctctggcacgtggacaacgagctgggatgccatgtc
ccgcacgacttctccgaccacgccgccgcggccttccgccgctggctcgagcgccgctac
ggcacgatcgaggcgctgaacgaggcctggggcacggccttctggtctcagcgctacagc
gacttcgcgcagatcctgccgccgcgggccgcgcccacctaccccaaccccacccagcag
ctcgacttcgcgcggtactcgagcgacgagctgctggcccactaccgggcgctgcgggag
gtgctggccgaggtgaccccgcacgtgccggccaccacgaacttcatgctctcctcggcg
acgaaatggatggactacttctcctgggccgaggacgtggacgtggtcgccaacgaccac
tacctcatcgccgcggacccgcgcggccagatcgagctggccttcgccgcggatctctcc
cgcggggtggccggcggggacccgtggatcctcatggagcactccacctccgcggtgaac
tggcagagccggaaccgcgccaagggcccgggggagatgctgcgcaactcgctctcgcac
ctggcgcgcggggccgacgggatcatgttcttccagtggcggcagtcccgcgccggcgcc
gagaagttccactcggcgatggtgccgcacgcggggacggagtccgaggtgtggcgcggc
acggtggcgctgggccgcgctctcgaggccctcgcgccggtgcgcggcagccgggtgctg
aaccgggtcgcgctggtgatggactacccctcctggtgggcgagcgagctggactcccac
cccacccaggcgctgcgctacagcgaggagatgctgcgctggtacacggcgctgtgggat
ctgggggtcggcgtggacgtggtgggcgtcggcgcggacctcaccggctacgagctggtc
atcgcccccacgctgtactccgtgagcgaggcgcaggccgccggggccgcggaggcggcg
cgggcgggcgcgcaggtggtgatcaccttcttctccgggatcgtggacgagcacgaccag
gtgcacctgggcggctacccgggggcgttccgcgacctgctcggggtgcgcagcgaggag
ttccacccgttgctcgagggggaggtgcaccacctcgacgacggcaccgccgcggacctg
tggagcgagcgcacgcacctcgagggcgcggaggcggtgcgccggtgggccgacgggccg
ctgcacggcctgcccgcggtgacgcggaacccggtgggggagggcgcggcctggtacgtc
gccgcccgcccgtcggccgaggggctcggggcgctggtggccgagatcgtggccgccgcc
ggggtggagccggccgtcgccggcctgcaccgggacgtggaggcggtgcgccgcttcgcc
gaggacggcaccacctatctgttcgtgctcaaccactccgagcgcgaccaggtggtgcag
gtcagcggggaggagctgctgcgcggcaccgtggcggacggtgccttgacggtgcatgcc
ggcgcggtggcggtgatccgcgaacgctga

DBGET integrated database retrieval system