KEGG   Brachybacterium saurashtrense: DWV08_16305Help
Entry
DWV08_16305       CDS       T05573                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bsau  Brachybacterium saurashtrense
Brite
KEGG Orthology (KO) [BR:bsau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsau01001]
    DWV08_16305
Enzymes [BR:bsau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DWV08_16305
Protein kinases [BR:bsau01001]
 Serine/threonine kinases: Other
  Bacterial family
   DWV08_16305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH PASTA NPCBM Kdo Kinase-like RIO1
Motif
Other DBs
NCBI-ProteinID: AXK47026
UniProt: A0A345YSX4
LinkDB All DBs
Position
3629757..3631670
Genome map
AA seq 637 aa AA seqDB search
MNERPVGSSYLLSDQRLGAGAMGVVYRGRDRQGNPYAIKVLRTEFAEDQVLVQKFVQERS
ALTGVDHPHVVVMRDLVVEGGTLAIVMELVEGHDLRAELASHGPLRPAEISSIGAAVASG
LAAVHAAGLIHRDLKPENVLLDTTGGRRVPKVADFGISRIADAAAATRSTVPMGTPNYAA
PEIADGKVPTGAADVYSLGIMLYELACGVTPFQGGSQLAVMRRHADDAVPRPEGIPEDLW
RTIVDMTAKDPLARPTAAQVALYLSQLEQRLSGERPAPQLTDPLPTVPLVPRNTASPTAA
LPADTGASPTVALSSPTARMTPVPRGARVTEAAPQEESVRRGRSRGMRRFFAVAAALMVL
GGAGGVFAYSQWGSDEAPDEAAERSTEATEGGETAPSGDSVEETVEATRVAAGDPTGDDA
GESESATAAPSPSPEEVLAMPDLVGQSLAEAKLSLPGTEISVVEQLDPDTVDNTILAQTV
PEGEEVPDSVEVTVARQPVTVYLDTLETADGYGFDTDLAHLDGETYPRSVVSDLWDDDGY
GEWNLGRGYREMVALVGRSDDATGAGETVQVDVYLDGRSVWSERVQVGNPVELRIDVTDA
LRLRIEYTSLEEEEAYLVLGDVHLLGLPEEVPEPADE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacggcccgtgggcagttcctacctgctcagcgaccagcggctcggggccggc
gcgatgggcgtcgtgtaccgaggccgcgaccggcaggggaacccctacgcgatcaaggtg
ctccgaaccgagttcgccgaggaccaggtgctggtgcagaagttcgtccaggagaggtcg
gcactgaccggggtcgaccatccgcatgtggtggtgatgcgcgacctggtcgtcgaagga
ggcacattggcgatcgtcatggagctcgtcgaaggccatgacctccgtgcagagctggcc
tcgcacggtccgctgcgaccagctgagatctcgtccatcggcgcagccgtcgcctcggga
ctggccgccgtccatgcggctggactcatccatcgcgatctcaagcccgagaacgtgctg
ctcgacacgaccgggggacgccgggtgccgaaggtcgccgatttcgggatctcacgcatc
gccgatgcggcagcggccaccaggtccaccgtgccgatgggcaccccgaactacgccgcc
ccggagatcgcggacgggaaggtgcccacgggagccgcggacgtgtactcgctggggatc
atgctctatgagctggcctgcggagtcacgccctttcaagggggaagtcagctcgccgtg
atgcggcgccacgccgacgacgcggtgccgcgcccggagggcatccctgaggacctgtgg
cggacgatcgtcgacatgaccgcgaaggatccgctcgcacggcccacggcggcacaggtc
gcgctctatctctctcagctggagcagcgtctgtcgggggagcgtcccgctccgcaactc
accgatccgctgccgaccgtgccgctggtgccccggaacaccgcttccccgacggccgcg
ctccctgcggacaccggcgcctctcccactgtcgcgctctcctcgcccacggcccggatg
accccggtgccgcgcggcgcaagggtgaccgaggccgctccgcaggaggagagtgtgcgg
cgcggccgctcccgcgggatgcggcgattcttcgcggtggccgctgcgctcatggtcctc
ggcggtgccggtggggtgttcgcgtactcgcagtggggctcggacgaagcccctgacgag
gccgcagagcgctccaccgaggccacggagggcggtgagactgcgccatcaggagactcg
gtcgaggagaccgtcgaggcgacgcgagtcgccgcgggcgatcccacgggcgatgacgca
ggcgagagcgagtccgcgaccgcagcgccgtcaccgtccccggaggaggtcctcgcgatg
cccgatctggtgggacagtcgctcgccgaggcgaagctctccctgccgggcaccgagata
tccgtggtggagcagctcgatccggacacggtggacaacacgatcctcgcgcagaccgtc
ccggaaggggaggaggtgccggacagcgtcgaggtgacggtcgcgcgacagccggtgacc
gtgtacctggacacccttgagacggcagacggatatggcttcgacaccgacctggcccac
ctggacggagagacgtacccgcgatcggtcgtctcggatctctgggacgacgacggctac
ggtgaatggaacctcggtcgcggctaccgcgagatggtggccctagtcgggcggtccgat
gatgcgacgggcgcaggggagacggtccaggtcgatgtctatctcgacggccgcagcgtg
tggtcggagcgggtacaggtcgggaacccggtggagctgcggatcgacgtgacagacgcg
ctccgtctgcgcatcgagtacacctcgctcgaggaggaagaagcgtatctggtcctcggt
gacgtccacctgctcggactgccggaggaagtccccgagcccgccgatgaatga

DBGET integrated database retrieval system