KEGG   Brevundimonas subvibrioides: Bresu_0521Help
Entry
Bresu_0521        CDS       T01291                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bresu_0521
Enzymes [BR:bsb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bresu_0521
DNA repair and recombination proteins [BR:bsb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bresu_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ADK99835
UniProt: D9QKL0
LinkDB All DBs
Position
522648..525227
Genome map
AA seq 859 aa AA seqDB search
MKGELKTYQAKRRFAETPEPKGTKATRKGAAPLRYLIQRHAATRLHYDFRIEFDGVLKSW
AVTKAPSRDTTVKRLAVEVEDHPLDYGSFEGTIPDGNYGAGTVQLWDTGTWSPRHPETLE
ADWAKGSIKMDLDGERLKGGWALVRLKSDRGKPSKWANWLLLKEKDAHAVPGEGDALAEI
DASITTGRSLAEIAAGKTPGTPTRPTGRKAAARPKAAPSGATLSKPPAFTPIQLCKVADH
PPSGAGWAHEIKFDGYRVQIATGGGKARLYTRSGLDWSQKFPEVVADAARWPDGVIDGEL
CALDPDHMPDFPALQAAISAGRTADLVFFAFDLLSEGTEDLREKPLSHRKARLSGHIDRM
SRAARDRIRYVDHFASTGQAVLESACRMDLEGVISKKLDAPYTAGRSSTWLKSKCRGGDE
VVIGGWSSENGTRFRSLLVGVREGEGLRYLGRVGTGYSQAVMKTLLPALKAAASDASPFA
GKGAPRGGRDIHWLKPVLVAEVTHGGYTESGSLRQAAFKGLRADKPAAEVTERPQTPTPT
GKAAPATDLHVPGEPAPLASARGKVVVAGVTISNPDKILWPARDGHPAITKAELARYYEA
AADRILPHVADRPTSIIRAPEGVGGETFFQRHAMPGSNPRLKLIDVHERKPYVAVVDVGG
LVAIGQSGGLELHPWGCAPGEPEIPDQVTFDLDPDEGLDFEDVISAARVVRKKLEALGLH
PFVKTTGGKGLHVVVPIKTDARSRVTWDQNKAFAKGVSEAIRAEAPDRFTTTLAKKARGG
KIFLDYLRNGRMATAVAPWSPRARPGAGIAFPLAWTQVKAGLDPTAFSLRTYPALLKKPD
PWKDFRVSAVSLKGALKKL
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgagctgaagacctatcaggccaagcgccgcttcgccgagacccccgaaccg
aagggcaccaaggccacccgcaagggggccgcgcccctgcgctacctgatccagcggcac
gcggccacgcggctgcactacgacttccgcatcgaattcgacggggtgctgaagtcctgg
gcggtgaccaaggccccgtcgcgcgacacgaccgtcaagcgtctggcggtggaggtcgag
gaccacccgctggactacggatcgttcgagggcacgattcccgacggcaactatggcgcg
ggcacggtccagctgtgggacaccggcacctggtcgccccggcatcccgagaccctggag
gcggactgggccaaggggtcgatcaagatggacctggacggagagcggctgaagggcggc
tgggcgctcgtccggctcaagtcggatcgcggcaagccctcgaaatgggccaactggctg
ctgctcaaggagaaggacgcccatgccgtgccgggcgagggggacgcgctggccgaaatc
gatgcctcgatcaccacgggccgaagtctggcggagatcgccgcgggcaagacgccgggg
accccgacacggccgacgggacgcaaggctgccgccagaccgaaggcggcgccgtccggg
gcgaccctgtcgaagccgccggccttcacgccgatccagctgtgcaaggtcgccgaccac
ccgccgtccggagccggctgggcgcatgagatcaagttcgacggttaccgcgtgcagatc
gcgacgggcggcggcaaggcccggctctacacgcgcagcggcctcgactggtcgcagaag
ttccccgaggtcgtcgccgacgcggcccgctggcccgacggggtgatcgacggcgaactg
tgcgcgctggaccccgaccacatgccggacttccccgccctgcaggcggccatctcggcc
ggcaggaccgccgacctggtcttcttcgccttcgacctgctgtccgaggggaccgaggac
ctgcgcgagaagccgctgtcccaccgcaaggcccggctcagcggccatatcgaccggatg
tccagggcggcacgggaccggatccgctacgtcgaccacttcgcctcgaccggccaggcg
gtgctggaaagcgcctgccggatggacctggagggcgtgatctccaagaagctggacgcg
ccctacaccgcggggcggtcgtccacctggctcaagtccaaatgccggggcggggacgag
gtcgtcatcggcggctggtcgtcggagaacggcacccggttccggtccctgctggtcggg
gtgcgggagggtgaaggcctgcgctatctcggccgcgtcggcaccggctattcgcaggcc
gtgatgaagacgctgctgccggccctgaaggcggcggcgtcggacgccagtcccttcgcg
ggcaagggcgcgccgcgcggcgggcgcgacatccactggctgaagccggtcctcgtcgcc
gaggtgacccacggcggctataccgaatccggatcgttgcgacaggccgccttcaagggc
ctgcgggcggacaagccggccgccgaggtcaccgagcgcccgcagaccccgaccccgacc
ggcaaggccgcgcctgccaccgacctgcatgtgccgggcgaacccgcgccgctcgcctcg
gcccggggcaaggtggtggtcgccggggtgacgatctccaatcccgacaagatcctgtgg
ccggcccgggacggtcatccggccatcaccaaggcggagctggcgcgctactacgaggcc
gcagccgaccgcatcctgccccatgtcgccgatcgccccacctcgatcatccgcgcgccc
gaaggcgtgggcggcgagaccttcttccagcgccacgccatgccggggtcgaacccccgg
ctgaagctgatcgatgtgcatgaacgcaaaccctatgtcgccgtcgtcgacgtcggcggg
ctggtcgccatcggccagtcgggcgggctggagcttcacccctggggctgcgcgccgggc
gagccggaaatcccggaccaggtcaccttcgacctcgaccccgacgaggggctcgatttc
gaggacgtgatctcggcggccagggtcgtgcggaaaaagctggaggcgctgggccttcat
cccttcgtcaagacgaccggcggcaaggggctgcacgtcgtcgtgccgatcaaaaccgac
gcccggagccgcgtgacctgggatcagaacaaggccttcgccaagggcgtgtccgaggcc
atccgggccgaggcgccggaccggttcacaacgaccctggccaagaaggcgcggggcggg
aagatcttcctcgactatctgcgcaacggccggatggcgaccgccgtcgccccgtggtcg
ccgcgcgcccggcccggcgcgggcatcgccttccccctggcctggacccaggtgaaggcg
ggcctggaccccaccgccttcagcctgcgtacctatccggcgctgctgaagaagccggat
ccgtggaaggatttccgggtctcggccgtcagcctgaagggggcgttgaagaagctctag

DBGET integrated database retrieval system