KEGG   Brevundimonas subvibrioides: Bresu_0579Help
Entry
Bresu_0579        CDS       T01291                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00061  Fatty acid biosynthesis
bsb01100  Metabolic pathways
bsb01212  Fatty acid metabolism
Module
bsb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bresu_0579
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsb01004]
    Bresu_0579
Enzymes [BR:bsb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Bresu_0579
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     Bresu_0579
Lipid biosynthesis proteins [BR:bsb01004]
 Fatty acid synthase
  Component type
   Bresu_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ADK99893
UniProt: D9QL38
LinkDB All DBs
Position
585191..585724
Genome map
AA seq 177 aa AA seqDB search
MNTSQYPSSFDHAALLASGRGELFGPGNAQLPAPPMLMFDRITQISGDGGEHGKGYVEAE
LDIHPDLWFFQCHFIGDPVMPGCLGLDAMWQLVGFYLGWIGGPGRGRALGVGEVKFTGQV
QPDVKKVTYKITLKRVINRRLVMGIADGVMEADGVPIYTATDMRVGLFQAGEKPVEA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacatcccaatacccgtcgtccttcgaccacgccgccctgctggcctcgggccgg
ggcgagttgttcgggccgggcaatgcccagctgcccgcgcccccgatgctgatgttcgac
cggatcacccagatcagcggcgacggcggcgagcacggcaagggctatgtcgaggccgag
ctggatatccatcccgacctctggttcttccagtgccacttcatcggcgacccggtcatg
ccgggctgcctgggtctggatgccatgtggcagcttgtcggcttctacctgggctggatc
ggcggcccggggcgcgggcgcgcgctgggcgtcggtgaggtcaagttcaccggccaggtc
cagcccgatgtgaagaaagtgacctacaagatcacgctgaagcgggtcatcaaccgtcgc
ctggtcatgggaatcgccgacggggtgatggaagccgacggcgtgcctatctataccgca
accgacatgcgcgtcggactgttccaggcgggtgagaagcccgtcgaagcctga

DBGET integrated database retrieval system