KEGG   Brevundimonas subvibrioides: Bresu_0589Help
Entry
Bresu_0589        CDS       T01291                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00620  Pyruvate metabolism
bsb00680  Methane metabolism
bsb01100  Metabolic pathways
bsb01120  Microbial metabolism in diverse environments
bsb01200  Carbon metabolism
Module
bsb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bresu_0589
  09102 Energy metabolism
   00680 Methane metabolism
    Bresu_0589
Enzymes [BR:bsb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bresu_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ADK99903
UniProt: D9QL48
LinkDB All DBs
Position
594358..597066
Genome map
AA seq 902 aa AA seqDB search
MPVSAEPAADDRLREEVRLLGGLLGEVIRDEGGQDLYDRIEAVRVASVGYHRHSGARGSA
ELERLLSDLSLDDAVGLAHGFAVFSLLANVAEDRAGKRRARSQTAEGARPDTPEGSLARL
AQAGRSVEDARTLLSEALISPVLTAHPSEVRRKSVIDRIAAVSDLLDACDRDDLACAPEV
MVNGLRRQTVILWATRLVRTTGLVVQDEIDTVVSFLERVFLKVAPEQLIDWRRRLNAPDL
KPFIRIGAWVGGDRDGNPNVDAAALRAAFATPAKAVLRHYLEAVNTLGAELSLSGSLAAV
SPALQALAASSGDGSPHRADEPYRRALSQIYARLSATHPLLTGETAPRPAPFAAPPYDGP
DAFRDDLAVLQDSLVASHGAVFADDGLSRLIATVDVFGFHMATLDLRQNSDVHARVVGHL
LRVAGVCPDYAALDEEARIALLSAELAAPRLLFSPYEDYDPEVLKERAILQAAAEALRTF
GPQAIRTHIVSKTDAASDLLEVYLLLKEVGLYRHDDPATCPIQAAPLFETIDDLRAAKPT
LSRLLQEPSALAVARARGVQEVMIGYSDSNKDGSYLTSTWELHEASRALLSVTEAVGVRL
QLFHGRGGAVGRGGGSSFAGVISQPTGTVAGRIRITEQGEVIANKYGEPDVARRNLDALT
AGTLIASLAPPPDEAMTAKHGATASALSVASMAAYRALVYETPGFVDYFRAATPINEIAE
LKIGSRPTSRTASSAIEDLRAIPWVLSWSQSRVMLPGWFGFGSAVRGRDMEELRAMAADW
PFFRTLLQNMEMIMAKSDMTIARRYAGLVPDQALAASIFGALRAEWDRTRDAVLAITGQS
DLLGGQPELDRLIRLRMPYVEPLNHVQIELIRRRRSGDDDPRVREGILLTINGVAAGLRN
SG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtttccgccgaacccgccgccgacgatcgcctgcgcgaggaggttcgcctgctc
ggcggcctgctgggcgaggtgatccgcgacgagggtggacaggacctctacgaccggatc
gaagcggtgcgggtggcctcggtcggctatcaccgccattccggcgcgcgcgggtcggcg
gagctggagcggctgctgtcggacctgtcgctggacgacgcggtgggtctggcgcacggg
ttcgcggtcttctccctgctggccaatgtggccgaggaccgggccggcaagcgtcgggcc
cgcagtcagaccgccgagggcgcgcggcccgatacgcccgagggatcactggcccggctg
gcccaggccggtcgttccgtcgaggacgcgcggacgctgctgtccgaggccctgatctcg
ccggtcctgaccgcccacccgtcggaggtgcgccgaaagagcgtcatcgaccggatcgcc
gccgtgtcggacctgctggacgcctgcgaccgggacgacctggcctgcgcacccgaggtg
atggtcaacggcctgcgtcgacagacggtgatcctgtgggcgacgcggctggtccgaacc
acgggcctggtggttcaggacgagatcgacacggtggtctccttcctggaacgggtgttc
ctgaaggtcgcgccggaacagctgatcgactggcgcagacggctgaatgcgcccgacctc
aagcccttcatccgcatcggggcctgggtcgggggcgaccgggacggcaatcccaacgtc
gacgcggccgccctgcgcgccgccttcgccacgccggccaaggccgtgctgcgccactat
ctggaggcggtgaacaccctgggggccgagctcagcctgtcgggctcgctcgcggccgtc
agcccggccttgcaggccctggccgccagctccggcgacggctcgccccaccgggccgac
gaaccctatcgccgcgcgctcagccagatctatgcccggctgtcggcgacccatcccctg
ctgaccggagagaccgcgccccggcccgcgcccttcgccgccccgccctatgacggaccg
gacgctttccgggacgatctggcggtcctgcaggacagcctggtcgccagccacggcgcg
gtcttcgccgacgacggcctgtcgcgcctgatcgccacggtcgacgtgttcggcttccac
atggcgacgctggatctgcgccagaactcggacgtccatgcgcgggtggtcggacacctg
ctgcgcgtggccggggtctgtcccgactatgcggccctggacgaggaggcgcgcatcgcc
ctgctgtcggccgagctggcggccccccgcctgctgttcagcccctacgaagactacgat
ccggaggtgctgaaggagcgggccatcctccaggccgcggccgaggcgctgcgtaccttc
gggccccaggcgatccgcacccatatcgtgtccaagaccgacgccgcgtcggacctgctg
gaggtctaccttctgctcaaggaggtcggtctgtatcgccatgacgatccggcgacctgc
ccgatccaggccgcgcccctgttcgagaccatcgacgacctgcgcgccgccaaaccgacc
ctcagccgattgctgcaggaaccctccgccctcgcggtcgccagggcgcggggcgtccag
gaggtgatgatcggttattcggactccaacaaggacggctcctacctgacctcgacctgg
gagctgcacgaggcctcgcgcgccctgctgagcgtgacggaggcggtcggcgtgcggctg
cagctgttccacggccggggcggcgcggttggaaggggcggcgggtccagcttcgccggg
gtcatctcccagcccacgggcacggtcgcgggccggatccgcatcaccgaacagggcgag
gtgatcgccaacaaatacggcgagcccgacgtggcgcgccgaaatctggacgccctgacg
gccgggaccctgatcgcctcgctcgccccgcccccggacgaggcgatgacggcgaagcac
ggcgcgacggcctcggccctgtcggtcgcctcgatggcggcctaccgggcgctggtctac
gagacgccgggcttcgtcgactatttccgggcggccaccccgatcaacgagatcgccgag
ctgaagatcggctcgcggccgacgtcgcggaccgcctccagcgccatcgaggacctgcgc
gccatcccctgggtgctgagctggagccagtcgcgcgtgatgctgccgggctggttcggc
ttcggctcggccgttcgggggcgggacatggaggagctgcgcgccatggccgcggactgg
cccttcttccgcaccctgctccagaacatggagatgatcatggccaagtccgacatgacc
atcgcgcggcgctatgccgggctggtgccggaccaggcgctggccgcctccatcttcggg
gccctgcgggccgaatgggatcgcacccgcgacgcggtcctggccatcaccggccagtcc
gacctgctgggcggccagcccgagctggaccggctgatccggctgcggatgccctatgtc
gagccgctgaaccacgtgcagatcgagctgatccgccggcggcgctcgggcgacgacgat
ccccgcgtgcgcgagggcatcctgctgacgatcaatggcgtggccgccggcctgcgcaac
agcggctag

DBGET integrated database retrieval system