KEGG   Brevundimonas subvibrioides: Bresu_2203Help
Entry
Bresu_2203        CDS       T01291                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00061  Fatty acid biosynthesis
bsb00620  Pyruvate metabolism
bsb00640  Propanoate metabolism
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01200  Carbon metabolism
bsb01212  Fatty acid metabolism
Module
bsb_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bresu_2203
   00640 Propanoate metabolism
    Bresu_2203
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bresu_2203
Enzymes [BR:bsb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Bresu_2203
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Bresu_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ADL01513
UniProt: D9QJF2
LinkDB All DBs
Position
2205113..2206465
Genome map
AA seq 450 aa AA seqDB search
MFTKVLIANRGEIALRIHRACKEMGISTVAVHSEADRGAMWVRLADESVCIGPAPAAKSY
LNIPSIIAAAEITGAQAIHPGYGFLSENARFAEIVEAHGMTFIGPRPEHIRIMGDKITAK
QTVLEAGIPCVPGSPGEVETVEDAIAASKSIGFPLIVKASAGGGGRGMKVALTADDLVEA
VQTAQSEALAAFGNGAVYMERYLQKPRHIEIQVIADSHGNVVHLGERDCSLQRRHQKVLE
EAPSPALSAAERVAIGETVNKAIAKIGYLGVGTIEFLWEDGEFFFIEMNTRLQVEHPVTE
AITGVDLVREQIRIAAGLPLSFTQEDIHFEGHAIEVRINAENAETFTPSPGTITDFHAPG
GLGVRLDSAIYAGYSIPPFYDSLIGKLIVHGRDRAECIARLKRSLNEMVIGGIDTTIPLF
QKLLAEPDILSGDYDIHWLENWAKRQKGQA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaaggtcctgatcgccaaccgcggcgaaatcgcgctgcgcatccaccgcgcg
tgcaaggagatgggcatctccaccgtcgccgtgcactccgaggccgatcgcggggccatg
tgggtccggctggccgacgagagcgtctgcatcggaccggccccggccgccaaatcctat
ctgaacatcccctcgatcatcgcggcggctgaaatcaccggggcccaggccatccacccc
ggctacggcttcctgtcggaaaacgcgcgcttcgccgagatcgtcgaggcccacggcatg
accttcatcgggccccggcccgagcacatccggatcatgggcgacaagatcacggccaag
cagaccgtgctggaagccggcatcccctgcgtgcccggttcgcccggcgaggtcgagacg
gtcgaggacgcgatcgccgcgtcgaaatccatcggctttccgctgatcgtgaaggcctcc
gccggcggcggcgggcgcggcatgaaggtcgccctgacggccgacgatctggtcgaggcc
gtccagacggcccagtccgaggccctcgccgccttcggcaacggcgcggtgtacatggag
cgctatctccagaagccgcgccacatcgagatccaggtcatcgccgacagccacggcaac
gtcgtccacctgggcgagcgcgactgctcgctgcagcgccgccaccagaaggtgctggaa
gaggccccctcgcccgccctgtcggctgccgagcgcgtcgccatcggcgagacggtgaac
aaggcgatcgccaagatcggctacctgggcgtcggcacgatcgaattcttgtgggaggac
ggcgagttcttcttcatcgagatgaacacccgtctgcaggtcgaacacccggtcaccgaa
gccatcaccggcgtcgacctggtgcgcgaacagatccgcatcgccgccggcctgccgctg
tccttcacccaggaggacatccacttcgagggtcacgccatcgaggtgcggatcaacgcc
gagaacgccgagaccttcacgccctcgcccggcaccatcaccgacttccacgcccccggc
ggcctcggcgtgcggctggatagcgccatctacgccggctattcgatcccgcccttctac
gacagcctgatcggcaagctgatcgtccatggccgcgaccgggccgaatgcatcgcccgg
ctcaagcgcagcctgaacgagatggtcatcggcggaatcgacacgaccattccgctgttc
cagaagctactggccgagcccgacatcctgtcgggggattacgacatccactggctggaa
aactgggcgaagcggcagaagggccaggcctag

DBGET integrated database retrieval system