KEGG   Bipolaris sorokiniana: COCSADRAFT_114116Help
Entry
COCSADRAFT_114116 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K10846  DNA excision repair protein ERCC-5
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    COCSADRAFT_114116
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsc03400]
    COCSADRAFT_114116
DNA repair and recombination proteins [BR:bsc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     COCSADRAFT_114116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc Transposase_20 UIM PUB_1 HHH_5 HHH
Motif
Other DBs
NCBI-GeneID: 19130248
NCBI-ProteinID: XP_007698556
JGI: Cocsa1_114116
UniProt: M2SDK9
LinkDB All DBs
Position
Unknown
AA seq 1213 aa AA seqDB search
MGVTGLWTVLQPCARPIKIETLNKKRLAVDASIWIYQFLKAVRDKEGNALRNSHIVGFFR
RVCKLLFIGIKPVFVFDGGAPALKRQTIRHRKSRREGRRDDALKTAGKLLAIQMQRAAEE
EDRKRKEAAKHPRENQQDEEIPENLVYADELLKTPQERTQNHTFKRKDQYHLPDLGKSMS
EMGAANDPRVMSLEELEEYARQFDRGEDINVYDFSKIDFDGHFFQSLPPADRYNILNAAR
LRSRLRMGHSKEQLDAMFPDRMAFSKFQIERVRERNELTQRLMNLNGMNDDAFGSGGFNR
VAGERDREYVLVKNDGVEGGWALGVVLNKEAGKAHKPIEVEPPQPPAKDDDEWEDDEDFE
DVPIEGLNRLPKPKAGLSAQEKEGREFIANELATRRRRLYRSRKEMPKQSAPKRAVPVDQ
NPDSLFLADDNDDQDWMDVHVSGSNNLAEEAGDELENEQLQQAIALSMQSGVQQHQETAE
ESEEDPVREVFQQRRAEETNPFARTKGSGLAIGRLANQRSSKLATKGPFEGSDSEDEMDL
QGALAESRKSKRPTNVQKPSSQSNAQNSSSTVESAPGKINSSGFDGPLPFERLNLGNSLL
GKKKMEKLEAENAGGFEKNYAEEKKTAAPLPPWFNASRDIASEVNSQRQEEKLLWEEARQ
EEKNRFQFQELPSLRKQDTKEVIDLDAPASQSQKQVIAIDSDEDADAQMEDVQTRETELK
MGDLADKVRAEPPKPLFSHQPSPPPQDPALLKKIPFAEDSDEQPVDWSESEPEDEKHARQ
KVTSDVEPKSEARQASETPSDEFEDDVPLQGETNSAPEQSKSPSPEFEDVPIRQEKPRQP
QREFSPLQGPEDLTKPIVPYSGVADDSIPMDIAEGNDSDQYSDPEDEELFASLAKEAEEH
ARFAQELSNNTAARVDFDEELKQLRAQQKKDRRDADEVTQTMISECQQLLALFGLPYITA
PMEAEAQCAELVNLGLVDGIVTDDSDTFLFGGTRVYKNMFNAAKFVECYLSSDLTSEFSL
TRQKLIDIAQLLGSDYTEGIPGIGPVTALEILSEFQDLTAFRKWWDGVQNGSIKKSDDAQ
SSFRRRFRKNQATKLFLPASFPDPRVADAYLNPEVDSSPEPFQWGVPDLAALRAYLSSQI
GWSTERTDEVLVPVIRDMNRREKEGTQANITRFFEGSVGAGAFAPRVRGAEAGGPSGKRK
GKGAAGKRLGAAL
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttactggcctttggaccgttttacaaccctgcgcgcggccgattaagattgag
acgctgaacaagaaacgactggctgtcgatgcgtccatctggatctaccagttcctcaaa
gccgtgcgcgacaaggaaggaaatgcgttgcggaacagccatatcgtcggcttcttccgc
cgagtatgcaagctacttttcatcggcataaagcctgtgttcgtctttgacgggggcgcc
ccggccctgaagcgacagactatccgccaccggaagtcgcgccgggagggcagacgagat
gatgcactcaagacagccgggaagttgttggcaatacagatgcagagggctgcggaggaa
gaggataggaagaggaaggaagctgccaaacatccacgggaaaaccagcaagacgaggag
atacctgaaaacttggtctatgcagacgaactactcaaaacgccccaggaacggactcag
aaccacacattcaaaagaaaagatcaatatcatttgccagacctgggaaagtccatgtcg
gaaatgggcgctgcgaacgaccccagagtcatgtctctagaggaactggaagagtatgca
cggcagttcgatagaggcgaagatatcaatgtttatgatttctccaagatcgactttgat
ggccactttttccaaagtttgccacccgccgatcgctataatatcctgaacgcagccagg
ctgcgaagtcggctgaggatgggtcactcgaaggaacaactcgatgcaatgtttcccgac
agaatggcgttctccaagttccagattgagcgtgtgcgcgaacgtaatgaacttacgcaa
cgcttgatgaatctcaacggcatgaacgatgatgcctttggaagtggtggtttcaatcgc
gttgctggtgagagagacagggagtatgtccttgtaaagaatgacggggttgagggtggt
tgggcccttggagtggtcttgaacaaggaagctggaaaagcccacaaaccaatcgaggta
gagccgccacaacccccagctaaagatgatgatgaatgggaagacgatgaagattttgag
gacgtgccaattgagggcttgaatcgactccctaaacctaaagcaggattgagtgcccag
gaaaaggaaggtcgtgaattcattgcaaatgagttggcaacacggcgtcggcggctttac
agatcaaggaaggaaatgccaaagcagtctgcgcccaagagggccgtgcctgtggatcaa
aatcccgattcgttgttccttgctgatgacaacgacgaccaagactggatggacgtgcat
gttagtggcagcaataatttggccgaggaggcgggcgacgaacttgagaacgaacagttg
cagcaagcgattgcattgtcaatgcaatcaggagtacaacaacatcaagaaactgctgaa
gagtctgaagaagatccagttcgcgaggtttttcaacaaaggcgtgctgaagaaactaat
cccttcgccaggaccaagggctctggacttgctattggaaggcttgccaatcaacgaagt
agcaaactagctacgaagggcccttttgaaggtagtgatagcgaagatgagatggacctt
cagggtgcgcttgcagagtctcgcaagtcaaaacgtcctaccaacgtacaaaaaccatcc
tctcaatctaacgctcagaattcttcatcaactgtcgaatctgcgccaggaaagatcaac
tcctcgggcttcgatgggcctcttccgtttgagagactcaatttgggtaactccctgctt
ggcaagaaaaagatggaaaagttggaggctgagaatgctggaggcttcgagaaaaactac
gcagaggaaaaaaagaccgcagcaccacttccgccttggttcaacgcgtcacgggatatt
gcttcagaagtcaactctcaacgacaagaagagaagttgttatgggaggaagctcgtcaa
gaagaaaagaacaggttccagttccaagaactcccgagtttgcgcaagcaagatacaaag
gaagtcattgacctagatgcacccgcgagtcaaagccagaagcaagtgatagcgatcgac
tcagatgaagatgctgatgcccagatggaggatgtacaaactagagaaactgagttgaag
atgggtgatctggccgacaaagttagagcagagccaccaaaaccgcttttctctcatcag
ccatcgccacctcctcaagatcctgccttgctgaagaagattccattcgccgaggattct
gatgaacagccagtggactggtcggagagtgagccggaagacgaaaagcacgcgcgacag
aaagtaacaagcgatgtggagccaaagtcagaggcacggcaagcttctgaaactccatct
gacgaatttgaagatgatgtacctttgcaaggtgaaactaattcagcgcccgagcagtca
aagtccccatcgcctgaatttgaggacgtcccgattagacaggaaaagccgcgtcaaccc
caaagagagttttcgccattacagggtccagaagaccttaccaagccaattgtcccatac
agtggcgttgctgacgacagtattcctatggatattgcagaaggtaatgattctgaccaa
tactctgatccagaagatgaagagctatttgcatctctcgccaaagaggcagaagagcat
gcccggtttgcccaggaactaagcaacaacaccgccgcacgggtagactttgacgaagaa
ctcaagcaactacgtgctcagcagaaaaaagaccgtcgagacgccgacgaagtcacacaa
acaatgatttccgagtgccaacagctcctcgccctattcggcctcccatacatcaccgcg
cccatggaagccgaagcccaatgcgccgaacttgttaacctaggcctcgtcgacggcatc
gtaaccgacgactcggacacgttcctcttcggcggcacccgcgtctataaaaacatgttc
aacgccgccaaattcgtcgaatgctacctctcctccgacctaacctctgaattcagcctc
acccgccaaaaactaatcgacatcgcccaactcctgggttccgactacacagaaggcata
ccgggcatcgggcccgtgaccgcactagaaatcctctctgagtttcaagatctgaccgcg
ttcagaaagtggtgggacggcgtacaaaacgggtctatcaaaaaatccgacgacgcccaa
tcgtcgtttcgacgacgcttccgtaaaaatcaagctactaagcttttcctacctgcttct
tttccagacccaagggtagcagacgcatatctcaacccagaagtcgactccagccccgag
cccttccaatggggcgtccccgatctcgctgctctgcgcgcgtacctcagttcgcagatt
ggatggagcaccgagcgcacggacgaggtgcttgtgcctgttatccgcgatatgaatcgt
agggagaaggaggggacacaagcgaatattacgaggttttttgaggggagtgttggggcg
ggggcgtttgcaccgagggttaggggggcggaggcgggtgggccgagtgggaagaggaag
gggaagggtgctgcggggaagaggttgggggctgcattg

DBGET integrated database retrieval system