KEGG   Bipolaris sorokiniana: COCSADRAFT_116949Help
Entry
COCSADRAFT_116949 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00730  Thiamine metabolism
bsc00790  Folate biosynthesis
bsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    COCSADRAFT_116949
   00790 Folate biosynthesis
    COCSADRAFT_116949
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsc04147]
    COCSADRAFT_116949
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsc00537]
    COCSADRAFT_116949
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     COCSADRAFT_116949
Exosome [BR:bsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCSADRAFT_116949
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsc00537]
 Enzymes
  COCSADRAFT_116949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Adeno_E3
Motif
Other DBs
NCBI-GeneID: 19130345
NCBI-ProteinID: XP_007699945
JGI: Cocsa1_116949
UniProt: M2RB00
LinkDB All DBs
Position
Unknown
AA seq 596 aa AA seqDB search
MSGARPLLSNRASSEISGGRDLAEEDALLTGRRTGYGEKGYSQSQKWREVGLFVWAVIAT
GAVVVLGILLQSSSDSKTPQASGKRNLIFMVSDGMGPTSLSLTRSFMQFQNGAPFNEQLV
IDQHLIGQSRTRSSSSLITDSAAGATAFSCAQKSYNGAISVTPDHEPCGTVLEAAKKAGY
MTGLVVTTRITDATPACFAAHVNMRSEEDRIAEQMVGDHPLGRVVDLMFGGGRCHFLSNS
TGDSSCRADDKDIVGVAKKNGFNYISDRAGFDNLKGGASVDFPMLGLFAATDIPYEIDRR
NQNDIYPSLHEMAEAAMKALSHATRDSDKGFFLMIEGSRIDHAGHHNDPAAQVHEVLAYD
KTFNSVLNFIKKEKTQTVMVSTSDHETGGLAAARQLHASYPEYLWYPSPLANASHSAEHL
ALAYNTFLATKPSADQTADFIRDSITTGLGIHDFNDDEVNNLVKDPATSLYQYADMISRR
SQTGWSTHGHSAADVNIYTSDPEAAHALQGNHENTEVGQFLRDYLNVDVNAVTRELLEKG
RGLTVQDFNGTEVSWMGKIPDVGERLDGQTHLASYGGDFKKRNEGVLHGEACGCGH
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtgctcgccccctactgtcgaaccgcgcgtcttctgagataagcggtggccgc
gacctggcagaagaagatgccctactcacaggccgccggaccggatacggagagaaggga
tattcgcaatcacagaaatggagagaagtaggactgtttgtctgggctgttattgcaaca
ggcgctgtcgttgtactcggcattcttctccaaagttcgagtgactccaagacaccccaa
gcaagtgggaagaggaacctgatatttatggtttctgatggcatgggccctacctcgcta
tctctcacgcgatctttcatgcagttccagaatggcgctcctttcaatgagcagctcgtc
attgatcagcaccttatcggccagtcacgaacacgctcctcttcctcgctcatcaccgac
tcagcagccggtgcgacggccttctcttgcgcgcaaaagagctacaacggtgccatttcc
gtaacaccggatcatgagccatgcggtactgtgctggaagcggctaagaaggcgggatac
atgaccggcttggtagttacaacgcgcatcactgatgctacgccggcgtgctttgctgcg
catgtgaacatgcgatctgaggaagaccgtattgcggaacaaatggttggagaccatccg
cttggacgtgtggttgacttgatgtttggcggtggccgatgccacttcttatcaaactcg
accggcgattcgagctgtcgagccgatgacaaggacattgtcggggtggccaagaagaat
ggattcaactacatctcggaccgtgctggattcgacaatttgaagggcggagcttcggtc
gacttccccatgttaggactctttgctgccacagatatcccttatgaaatcgaccgccgc
aatcaaaacgacatctacccaagtctgcacgagatggccgaggccgccatgaaggcgctc
agccatgcgaccagggatagcgacaagggctttttcctaatgattgagggttccaggatc
gatcatgcaggccaccacaacgaccctgctgctcaagtccacgaggtgcttgcatatgac
aagacttttaacagcgtgctcaactttatcaagaaggagaagacacagaccgtcatggtt
tcgacatctgaccacgaaactggtggcctagcagccgctcgacaactccatgcttcatac
cccgaatatctctggtacccatctcccctcgccaacgcctcccactctgccgaacatctc
gctctcgcctacaacacgttcctcgcaaccaaaccctcggccgatcaaaccgccgacttt
atccgcgattccatcaccaccggtctgggtatccacgatttcaacgatgacgaagtcaac
aatctcgtcaaggatcccgcaacttccctctaccaatacgcagacatgatttcgcgccgc
tcgcagacgggctggtcgactcacggtcacagcgccgcagacgtgaacatctatacctct
gatcccgaagctgcacacgcactccagggtaaccatgagaacaccgaggttggccagttc
ctgagggactatctgaatgtcgatgtcaatgctgtaacgagggaactgctcgaaaagggc
cggggattgacggtgcaggatttcaatggcactgaagtcagttggatgggtaagattccg
gatgtgggcgagagactggatggccagacgcatttggcgagttatgggggtgatttcaag
aagaggaatgagggtgttttgcatggcgaggcgtgtggatgtgggcattaa

DBGET integrated database retrieval system