KEGG   Bipolaris sorokiniana: COCSADRAFT_118858Help
Entry
COCSADRAFT_118858 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bsc00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    COCSADRAFT_118858
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     COCSADRAFT_118858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 19130397
NCBI-ProteinID: XP_007700727
JGI: Cocsa1_118858
UniProt: M2S8N7
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSNIKGTVTFEQADESSPTTISWDITGHDANAERGMHIHAFGDNTNGCTS
AGPHFNPHNKTHGAPSDEERHVGDLGNFKTDGQGNAKGTVTDKLIKLIGSESVIGRTIVV
HAGTDDLGKGGHEESKKTGNAGGRPACGVIGISN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagccgtcgccgtcctccgtggagactccaacatcaagggaactgtcaccttt
gagcaggccgacgagtcctcccccaccaccatctcatgggacattaccggccacgatgcc
aacgctgagcgtggcatgcacattcacgccttcggcgacaacacaaacggctgcacatct
gctggaccccacttcaacccccacaacaagacccacggtgcccccagcgacgaggagcgc
cacgtcggtgacctgggcaacttcaagactgacggccagggcaatgctaagggaaccgtc
accgataagctgatcaagctgattggctccgagagcgtcattggccgcaccattgtcgtc
cacgccggcactgacgaccttggcaagggtggccacgaggagtccaagaagactggtaac
gctggaggccgtcctgcttgcggtgtcattggtatctccaactaa

DBGET integrated database retrieval system