KEGG   Bipolaris sorokiniana: COCSADRAFT_122288Help
Entry
COCSADRAFT_122288 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00020  Citrate cycle (TCA cycle)
bsc00190  Oxidative phosphorylation
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
bsc01200  Carbon metabolism
Module
bsc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCSADRAFT_122288
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    COCSADRAFT_122288
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     COCSADRAFT_122288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 19130516
NCBI-ProteinID: XP_007702375
JGI: Cocsa1_122288
UniProt: M2SI37
LinkDB All DBs
Position
Unknown
AA seq 306 aa AA seqDB search
MACTRALTRLALRPAAVRPAVFSRSFASVTDVHARDPISKTAEKIVPDAAQKPIPESKTS
NIKESSPTKDAKMKTFHVYRWNPDEPTSKPKMQSYTLDLNKTGPMMLDALIRIKNEMDPT
LTFRRSCREGICGSCAMNIDGVNTLACLCRIPTDAAKESRIYPLPHMYVVKDLVPDMTLF
YKQYRSVKPYLQRSTPAPDGREFRQSKEDRKKLDGLYECILCACCSTSCPSYWWNQEEYL
GPAVLLQSYRWIADSRDEKKAERQDALNNSMSLYRCHTILNCSRTCPKGLNPALAIAEIK
KSMAFT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcactcgcgctcttactcgtctggcgctgagaccagctgccgtccggccggca
gttttctctcgcagcttcgcctccgttaccgatgtccacgcccgcgaccccatctccaag
actgccgaaaagattgtgcctgatgccgcgcagaaacccattccagagagcaagacgtcc
aacatcaaggagtcctcgcccaccaaagatgccaaaatgaagactttccacgtctaccgc
tggaatcctgacgagcccacatccaagcccaagatgcaatcgtacactctggacctgaac
aagaccggacccatgatgttggatgcactcatcaggattaagaacgagatggacccgact
ttgacctttaggcggagttgtcgtgagggtatttgcggaagctgcgccatgaacattgac
ggagtcaacacactggcatgtctttgccgtattcccaccgacgcagccaaggagtctcgc
atatacccgctcccccacatgtacgttgtcaaggaccttgtgccagacatgacgcttttc
tacaagcaataccgttccgtcaagccatatctgcagcgctccacccctgcgccagatggt
cgtgagttccgtcagtccaaggaagaccgcaagaagcttgatggtctttatgaatgcatt
ctctgcgcctgctgctcaacctcgtgcccctcgtactggtggaaccaggaggagtacctt
ggacccgctgtcctcctccagtcctaccgatggatcgccgactcgcgtgatgagaagaag
gccgagcgccaggacgcacttaacaacagcatgagcttgtaccgatgccacaccattctc
aactgctcaaggacatgccccaagggactgaaccctgcgctggccattgccgagatcaag
aagagcatggcttttacataa

DBGET integrated database retrieval system