KEGG   Bipolaris sorokiniana: COCSADRAFT_123285Help
Entry
COCSADRAFT_123285 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    COCSADRAFT_123285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsc03036]
    COCSADRAFT_123285
Enzymes [BR:bsc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     COCSADRAFT_123285
Chromosome and associated proteins [BR:bsc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     COCSADRAFT_123285
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    COCSADRAFT_123285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo Kre28
Motif
Other DBs
NCBI-GeneID: 19130553
NCBI-ProteinID: XP_007702850
JGI: Cocsa1_123285
UniProt: M2SX39
LinkDB All DBs
Position
Unknown
AA seq 520 aa AA seqDB search
MPSMVVIPSNGYTRRRVLVDRVHSIVSNRVEKDDEQYLVRWNTNNALDQAPLSWHSIKEL
LRCLEHVQDYLEVREKSMVSLEQVQPTTKKRKTPDSGLEDERRSSPFDPHLYHANHGGQT
PSFSQSPTATPPPSSPPDVYNGVIDADEHGYIFCHTSTGPDVPKIPIHSVPTPEMKQTAQ
RSSVDKALAYIRNEYIRRLSKVTGKDSKPIKLVNLVDSSTPSLRFRYISDYILQPGVIRA
PPETQTGCQSCSPHMGRDIGCEYTKKCDCLEYAAVDESRLDSTQQLQYQHALENGLSTMG
FPKKFPYYAAGTKRERTGCLVPFYLKSRSPIYECNDKCNCGRHCRNKNVQFGRQVEVEIF
RAADGRGWGLRCTEDLYEGQFIDTYRGEIITDAEAERRENASSSKAKASYLYSLDKFKES
EGLEDKDLYVVDGEFMGGPTKFINHSCDPNCRQYTVSYNRHDARVYDIAFFACRFIPRGE
ELTFDYLDKDEGEEDEMDEPGEGAIPCLCGTKKCRKWLWT
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccatggtcgtcataccatcaaatggctatacgaggcggcgcgtcctcgtcgat
cgcgttcactcgatagtctcaaatcgtgtggaaaaggatgatgaacaatacctagtccgg
tggaacaccaataatgcattggatcaagcgccgctgagctggcattcgatcaaagaactc
ttacgatgtctcgagcacgtgcaagattacctcgaagtgagagagaagtctatggtatca
cttgaacaagtgcaacctacaacaaaaaagcgcaaaacaccagacagtggcctggaggat
gaacgccgctcttcaccgtttgatcctcacctttaccatgcaaaccatggaggccagacg
ccgtctttctctcagtctccgacagcaacacctccaccttcatctccacccgatgtatac
aacggcgtcatagatgccgacgagcatgggtacatcttctgccatacgtccacaggacca
gacgtaccaaagatccctatccacagcgtcccaacaccagaaatgaagcagaccgcacaa
agatctagtgtcgacaaagcactagcctacatccgcaacgagtacatccgccgactatcc
aaagtcacaggcaaagacagcaagcccattaaactagtcaatctcgtagactcctccacc
ccctccctccgctttcgctacatatccgactacatcctccaaccgggcgtcatccgcgca
ccccccgagacccaaacaggctgccagtcatgctccccacacatgggccgggacatcggc
tgcgaatacacgaaaaaatgcgattgtcttgagtacgccgccgtcgacgaatcgcggctc
gactccacccagcaactacagtaccaacatgcgcttgagaacggtctctccaccatgggc
ttccccaaaaaattcccatactacgccgcaggcacaaagcgcgagcgcacggggtgcctc
gtccccttctacctcaagtcgcgcagccccatctacgaatgcaacgacaagtgcaactgc
gggcgccactgtcgcaacaaaaacgtgcagtttgggcggcaggttgaagtcgaaatcttc
cgtgctgccgacggccgcggttggggtctgcggtgtacggaggacctgtacgagggccag
ttcatcgatacgtaccgtggcgagattattaccgatgccgaagctgaacgccgagaaaat
gcttcttcgtcgaaagctaaggcttcgtacctttattccctcgataaattcaaggagtcg
gaggggctcgaggacaaggatttgtatgttgtggacggagaattcatggggggcccgacc
aagtttattaatcattcttgcgatcccaattgtcggcagtatacggttagttataatcgg
catgatgccagggtttacgatattgcattctttgcgtgtaggtttattccgaggggggag
gaactcacgtttgattatctggataaggatgagggggaggaggacgagatggatgagccg
ggggagggcgcgattccgtgtctttgtgggacgaagaagtgtaggaagtggttgtggacg
tga

DBGET integrated database retrieval system