KEGG   Bipolaris sorokiniana: COCSADRAFT_123573Help
Entry
COCSADRAFT_123573 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
Organism
bsc  Bipolaris sorokiniana
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 19130565
NCBI-ProteinID: XP_007702960
JGI: Cocsa1_123573
UniProt: M2SGZ6
LinkDB All DBs
Position
Unknown
AA seq 700 aa AA seqDB search
MQQASSPVLQQQLRLHPESLQTLHQSTDGTLYPHHHQGLPELQTLHTTDIVYQQPYALTG
PPQPQPPSHALPVHFEQRGLPPSGPYPSFPAASYQQHVASPRFIDAPPPPLQEHAQQHYH
IAAPETAQKPIQQLPFSPSVPTTLQTTHPLPQHVEQAPLQQQSQPQPQPQPQPQPHRQEG
RDGDDAPFSSHGQFQGLKLIPNPPNLEEWRNKLFHVDDMITLTEEQFQTYFPHIDNIYSH
RSTQKHKRKRFVSHYWDCRLKGRPPGTKKSTDPDKKKRKRVARERDLCDVKIKITEFFDR
QEYEEQLGCRPPGTEDDGPSSIPTQPPVNPGQAVDQNQNPNPQFYGQGPLLPQQPAGGWD
MPPNMSGQPEVNLQQYMPPPSFPPQKFYTFQRVNGNGGNGKGDGVAGPHKHTLEESDRVK
KNSVIRWQMKADKEDKKKSHGGDPSKKTYHKKATGNALTTVKNHSKEDDLKLYGSAFCPF
VQRVWISLEHKQIPYQYIEVDPYKKPQSLLDVNPRGLVPALRHGPTWSTHESTVIMEYLE
DLQKGPPLLPPDAQSRATSRLWSDHINRNIIPYFYKLLQAQDQSDQVSHATEFRNQIGKL
VDAADPTGPFFLGPHISFVDVQIAPWIIRLRRVLGPYRGWPEAEAGSRWKQWVDAIEADK
SVRMTTSTDELYLDSYERYAENRPGTSQLADAVNSGRGLP
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagcctcttcgcccgtcctccagcagcagcttcgattgcaccctgaatccctt
cagacgctccaccagtcgaccgatggcacgctgtacccccaccatcaccaggggctgccc
gagcttcagaccctacacaccaccgacatagtataccagcaaccatacgccctgaccggc
ccaccccaaccacagcctccgtcgcatgccttgcccgtccactttgagcagcgtggcctg
ccgccctctggaccctatccatcattcccagctgcgagctaccagcaacatgttgccagc
ccgcgtttcatagatgcgccccctcccccgctgcaggaacatgcccaacaacactaccat
atcgctgcacccgagacagcgcaaaagccaattcagcagctccctttctcgccgtctgtt
ccaaccacactccaaacaacccatcccttgccacagcacgtagaacaggcgcctctccaa
cagcagtcgcaaccacaacctcagccgcagccgcagccgcagccgcatcgtcaggaaggg
cgcgacggtgatgacgccccattctcgagccatggtcaatttcaaggcctcaaactcatt
ccgaacccgccaaatctagaagaatggaggaataagctttttcacgtggatgacatgatc
acgttgaccgaggagcaattccaaacttatttcccacacatcgacaacatctactcgcat
cgctcaacgcaaaagcacaaacgcaagcgctttgtatcccattactgggactgccggcta
aaggggcgtccgccagggactaagaagtctacagacccagacaagaagaagcggaagaga
gtagcgcgagagcgagatttatgcgacgtgaagatcaaaataaccgagttttttgatcgt
caggaatatgaagaacagcttggatgccggcctccaggtaccgaggatgacggaccaagt
tcgataccaacacagccaccagtgaacccgggtcaggcggtagatcaaaatcagaaccca
aatcctcagttctacggacaaggtcccttgctgccacaacagccagctggaggttgggac
atgcctccaaatatgagcggtcaaccagaggtgaacctacaacagtatatgccgccaccc
agtttcccgccccaaaagttctacacctttcaaagggtgaacgggaacggtgggaatggc
aaaggtgatggcgttgctgggccacacaaacatacccttgaagaaagtgatcgagtgaag
aaaaatagtgttatcagatggcagatgaaagcggacaaagaagataaaaagaaatcacat
ggcggggatccttccaaaaagacataccacaaaaaggccactggcaatgccttgacaaca
gtgaagaaccattcgaaagaagatgatctcaagttgtacggcagcgcattttgccccttc
gtgcagcgtgtctggatatcactggagcacaagcaaataccctatcaatacatcgaagtc
gatccctacaaaaagccacagagtcttcttgacgtcaatccacgtggtttggttcctgcg
cttaggcatggaccaacatggtcaacccatgagtctactgtgattatggagtaccttgaa
gacctccagaagggaccgcctctcctacctcctgatgctcagagccgcgctacatcaaga
ctctggtctgaccacatcaaccgcaacattatcccgtacttttacaagctccttcaagct
caggaccaaagcgatcaagtttcacatgccaccgaatttcgtaatcaaatcggaaagcta
gttgatgcagcagatcctactgggccttttttccttggtccccatatttctttcgtagac
gtgcagattgcaccttggatcatccgattacgaagagtgctgggtccatacaggggatgg
ccagaggccgaggcggggagcaggtggaaacagtgggtcgatgcgattgaagcggataag
agtgtgaggatgactacgagcaccgatgagctttacctggatagctacgagaggtatgct
gaaaacagaccagggacgagtcagctagcagacgctgtcaacagtggaagggggctacct
tga

DBGET integrated database retrieval system