KEGG   Bipolaris sorokiniana: COCSADRAFT_132669Help
Entry
COCSADRAFT_132669 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00020  Citrate cycle (TCA cycle)
bsc00480  Glutathione metabolism
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
bsc01200  Carbon metabolism
bsc01210  2-Oxocarboxylic acid metabolism
bsc01230  Biosynthesis of amino acids
bsc04146  Peroxisome
Module
bsc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCSADRAFT_132669
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCSADRAFT_132669
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    COCSADRAFT_132669
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     COCSADRAFT_132669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19130860
NCBI-ProteinID: XP_007695249
JGI: Cocsa1_132669
UniProt: M2TN57
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MKPAVAASATIRHASSIAHLSRRQTCAFATRCLASHSPATSAQLLSPRRPATITARTTPT
SLYTLVAQHRMASSSPVKKIKVKNPVVELDGDEMTRIIWQVIKDKFIHPYLDIDLKYYDL
GLPYRDETDDQVTLDAAEAIKKYSVGVKCATITPDEQRVEEFKLKKMWLSPNGTIRNHLG
GTVFRAPIVIPTIPRLVPGWKQPIIIGRHAFGDQYRAKDRVIPGEGTLEMVFTPKGGKPE
VIKVYDFPAEGGVAQTQYNTTESISGFAHASFKMALDKKMPLYMSTKNTILKAYDGKFKD
VFQEIYDTQYKKDFEAANIWYEHRLIDDMVAQMIKSEGGYVIAMKNYDGDVQSDIVAQGF
GSLGLMTSTLITPDGKTFEAEAAHGTVTRHYREHQKGKETSTNPIASIFAWTQGLAKRGE
LDNTPELVVFAETLEKACIDTVDVDKIMTKDLALACGKKDRASWVTTNEYLDAVERRLKS
SLKEKL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggccgttgctgcctccgcgactatccgccatgcatcttcaattgcgcatctc
tcccgtcgccagacttgtgcttttgcaactcgctgtttagcttctcactcgcctgcgaca
tcggcccaacttctgagcccgcgacgaccagcaacaatcactgccagaacaacgcccacc
agcctatacactctcgtcgcacagcacagaatggcatcgtcttccccagtcaagaagatc
aaggtcaagaaccccgtcgtggagctcgatggtgatgagatgaccaggattatctggcaa
gtcatcaaagacaagtttatccacccctacctcgacattgacctcaagtactatgacctg
ggcctgccataccgtgatgagaccgacgaccaagtcacgctcgatgccgctgaggctatc
aaaaagtactcggttggtgtcaagtgcgcaaccattaccccagacgagcagcgtgtagaa
gagttcaagctcaagaaaatgtggttgtcgcccaatggcaccattcgaaaccatctagga
ggaaccgtcttccgcgcacccattgttatccccaccatccctcgtctcgtccctggatgg
aagcagcccatcatcattggccgccacgctttcggcgaccagtaccgcgccaaggaccgt
gtcattcctggtgagggaaccctggaaatggtcttcacaccaaagggcggcaagcccgag
gtgatcaaggtctacgacttccctgccgagggcggtgtcgcccagacccagtacaacaca
accgagtccatctcgggtttcgcacatgcctcgttcaagatggcgctcgacaagaagatg
ccactgtacatgagcaccaagaacaccattctcaaggcatacgacggaaagttcaaggac
gtcttccaggaaatctacgacacccagtacaagaaggactttgaggccgccaacatctgg
tatgagcaccgtctgattgacgacatggtcgctcagatgatcaagagcgagggtggctat
gttattgccatgaagaactacgacggagacgtccagtcggacattgtcgctcagggtttc
ggctctcttggtctcatgacttccacactcatcaccccagacggcaagacgttcgaggct
gaggccgcgcacggtaccgttacccgccactaccgtgagcaccaaaagggcaaggagaca
tctactaaccccattgcctccatctttgcctggacacaaggtctagccaagcgtggcgag
ctcgacaacacccctgaacttgtcgtctttgctgagacgctcgagaaggcctgcattgac
acggtcgacgttgacaagatcatgaccaaggatctggcgctagcgtgtggaaagaaggac
agggctagctgggtcacaaccaacgagtacctggacgcggtggaacgaaggctcaagtcg
agtttgaaggaaaagctataa

DBGET integrated database retrieval system