KEGG   Bipolaris sorokiniana: COCSADRAFT_166012Help
Entry
COCSADRAFT_166012 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00020  Citrate cycle (TCA cycle)
bsc00190  Oxidative phosphorylation
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
bsc01200  Carbon metabolism
Module
bsc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCSADRAFT_166012
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    COCSADRAFT_166012
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     COCSADRAFT_166012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 Lycopene_cycl DAO
Motif
Other DBs
NCBI-GeneID: 19132425
NCBI-ProteinID: XP_007694460
JGI: Cocsa1_166012
UniProt: M2TJX3
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MRFAVGQDPANLNLFAIVVGAGGAGLRAALGLTEAGLKTACVSKLFPTRSHTVAAQGGIN
AALANMHRDDWRWHMFDTVKGSDWLGDQDAIHYMTREAVPAVVELENYGMPFSRTEQGTI
YQRPLGGQTLNYGKGGQAYRTACAADRTGHAMLHTLYGQSLKMGVQFFIEWFALDLMMVE
GKCVGITAMNMEDGTCHRMFAKNTVLATGGYGRAYFSATSAHTSTGDGSAMAARAGLPLQ
DMEFVQFHPTGIYGAGVLITEGARGEGGYLLNSEGEAFMQNYAPISRNLASRDVVSRSMN
LEILKGRGCGPKKDHIDLQLMHLPKYIIEERLPGIAETAAIFAGIDVTRQCIPVLPTVHY
CMGGIPTNYHGQVLDVDRQSAKERTVDGLYAAGEAACVSVHGANRLGANSLLDIVVFGRA
AALHISSHHSPAAPHESTPDTIGLDAIHELTSFLTHSNGSTPTSVLRSKMQSTMQSTTAV
FRTHDTLAEGHAQLHSLENQFAADLHVTDKSLIWNSDLIETLELRNLLTNATQTSTAALK
RTESRGAHAREDFKERDDAQWMKHSLTWQRSVGEEVEFGTREVVMKTLDENEVASVPPRK
RYY
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgcagttggacaggatccagcgaatttaaatctatttgcaatcgtcgtcgga
gcaggaggagcaggtctccgcgcagcccttggtctcaccgaagctggcctcaaaaccgca
tgtgtatccaagctattccccacccgctcccacaccgtcgccgcccaaggcggcatcaac
gccgcccttgcaaacatgcacagggacgactggcgatggcacatgttcgataccgtcaaa
ggctccgattggctcggtgaccaagacgcaatacactacatgacacgcgaagccgttcct
gcagtcgtcgaactggaaaactacggtatgccttttagccggacagagcaaggtactatt
tatcaacggcccttgggtggtcagaccctcaactatggaaaaggtggacaggcgtatcgg
actgcttgtgcggccgaccgcacggggcatgctatgcttcatacgctttatggacagagt
ttgaaaatgggggtgcagttttttattgagtggtttgcgcttgatctgatgatggtggag
gggaaatgtgtgggtatcacggctatgaatatggaggatgggacgtgtcataggatgttt
gctaagaatacagtgttagctactggaggctacgggcgagcatactttagcgccacgagc
gctcacacaagtactggagatggtagtgcaatggctgccagagccggcctaccactccag
gacatggagtttgtccagtttcacccgactggtatctatggtgcaggtgtattaatcaca
gaaggcgcccgtggtgaaggcggctatcttctcaactctgaaggcgaggcattcatgcaa
aactatgcccccatctcaaggaacctcgcatcccgcgatgtggtcagccgaagtatgaat
ctggaaattctcaaaggccgtgggtgtggacccaaaaaagatcacattgacttgcagctc
atgcaccttccaaaatacattattgaggagcgcttgccaggcatagcggaaacagcggca
atatttgctggcatagacgtaactagacaatgcatcccggtgctgccaacagttcactac
tgtatgggtgggataccaacaaactaccacggtcaagttttggatgtagaccgccagagt
gccaaagaacgtactgtggatggcttgtatgcagcaggtgaagcggcttgcgtcagtgtc
cacggtgcaaaccgattgggtgccaactctctcctcgacattgttgtttttggccgagca
gctgcactccacatctcgtcacaccactcccccgcagcgccgcacgaatcaaccccggat
accattggcctcgacgctatccacgaactaacttctttcctcacccattccaacgggtcg
acccccacttccgtcttgagaagcaaaatgcaatctactatgcaatccaccacggccgtc
ttccgcactcacgatactcttgctgagggccacgctcaactccactcgctagagaatcaa
tttgctgcagatcttcatgtgactgataaatcgctgatttggaactctgacctcatcgag
acgctagagctgcgcaacctactcacaaacgctacgcagacgagtacagcagcgttgaag
cggacagagagccgaggtgcacatgcacgagaggacttcaaagagagagacgatgcacag
tggatgaagcatagtcttacgtggcagcgtagtgttggtgaggaggtcgagtttggaaca
agggaggtggtcatgaaaaccttggacgagaacgaagtagcgagtgtgccacctagaaag
cgatactattag

DBGET integrated database retrieval system