KEGG   Bipolaris sorokiniana: COCSADRAFT_175410Help
Entry
COCSADRAFT_175410 CDS       T03124                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00052  Galactose metabolism
bsc00500  Starch and sucrose metabolism
bsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCSADRAFT_175410
   00500 Starch and sucrose metabolism
    COCSADRAFT_175410
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     COCSADRAFT_175410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 19132965
NCBI-ProteinID: XP_007704585
JGI: Cocsa1_175410
UniProt: M2QWU5
LinkDB All DBs
Position
Unknown
AA seq 1047 aa AA seqDB search
MAQQILHQPNSDDYKGTTWPPWGTVNLQAALDRFSTAIMTHTSFVQASTVLSSLLALTAG
QTSTTSSNGGWSTTLAGTPTYFNPVFTIPPSADKGVQQIPNIYDSQAVDAQDVCPGYTAS
NLQQSPRGLTATLTLAGKPCNVYGTDIQELELKVEYQAQGRLSVNIVPKYIGASNQSHWI
VPEDLIPRPQVEESSEQTDLKFNWGNEPSFWFNVERSSTGDVIFTTQGTHLIYENQFVEF
VNSLPEDYNLYGLGERIHGLRLNNNFTATIYAADVGDPIDRNLYGSHPFYLETRYFEKGE
NCSTKPLTQSEIGQKKDAKTNGSPYESRSHGVYYRNTHGMDVVLKPDHLTWRTLGGAIDL
YFFDGPSSTDVTKAYQKSAIGLPAMQQYWTFGFHQCRWGYRNWTETREIVETMRAFNIPM
ETIWLDIDYMDQYRDFTLDPVTFPPSEVADFFGWLHRNNQHFVPIVDAAIYIPNPQNASD
AYDTYTRGNESGVFLSNPDGSQYIGAVWPGYTVFPDWLSPNGVSWWVKEMVEWYKEVPYS
GFWVDMTEVSSFCVGSCGTGNVTLNPAHPPFSLPGEVNNVIYDYPESFNITNGTEAASAS
AAASAQASRKATATATVTDEVTSTSTSYFRSTPTAGERNINYPPYVINHVQDGADLAVHA
VSPNATHTNGVEEYDVHNLFGHQIINATYQGLISVFPGKRPFIIGRSTFAGSGKWAGHWG
GDNASRWAYMFFSIPQALSFSLFGIPMFGVDTCGFNGNTDMELCSRWMQLSAFFPFYRNH
NVLSAIPQEPYRWEAVASASRTAMHIRYSLLPYMYTLFNDAHKTGSTVMRALAWEFPNEP
QLAGVDTQFLLGPNILVTPVLEPQVDTVKGVFPGIVDGETWFDWYSGERVQAEAGVNTTI
SAPLGHIPVYIRGGSVLPIQEPGYTTTESRQNPWGLIVALSSEGGASGHLYIDDGESIEP
ESCLDVTFAAISGKLEVDVQGEFKDTNALANVTVLGAPEVQHVKLNGEAIDASHVDYNKT
SGVLKLTGLTELTSSGAWQGSWTLTWE
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaaatccttcaccaaccaaacagcgatgactataaaggaacgacatggccg
ccatggggcactgtgaatcttcaggcagctcttgaccggttcagcaccgccatcatgacg
cacacgagtttcgttcaagcttccaccgtgctatcctctcttctcgcactcacagctggt
caaacgtccaccacttcttctaatggcgggtggagcactacgctcgctggcacgcccacc
tacttcaacccggtctttaccattcctccatctgcggacaagggcgttcagcagattccc
aacatctatgattcacaagccgtggatgcgcaagatgtttgccctggttacacggcatca
aaccttcaacagagtcctcgcggcctgaccgccacattgaccttggccggaaagccatgc
aatgtttacggcaccgatatccaggagctagagttgaaagtcgagtaccaggcccaggga
aggctgtcagtcaacatcgtaccaaaatacattggtgcaagcaaccaatcgcactggatc
gtccccgaagatctcattccgcgtcctcaggtcgaagaatcatccgaacagaccgacctc
aagttcaactggggcaacgagccatctttttggttcaatgtcgagcgctcctcgaccgga
gacgtcatcttcacaactcaaggcacccatctcatttatgaaaatcaatttgttgagttt
gtaaacagcctgccagaggactataatctctacggtctgggtgaacgaattcacggtctt
cgtctcaacaacaacttcactgcgaccatctatgctgctgacgtaggtgatcctatcgac
cgcaacctgtacggtagtcatcctttttacctagagacacggtactttgagaagggcgaa
aactgtagcaccaagcccttgacgcagtccgagatcggccagaagaaagatgccaaaaca
aatggttcgccttacgagtcgcgttctcacggcgtttattaccgcaacacccatggtatg
gacgtagtgctgaaacctgatcacctaacttggaggactttgggaggtgctattgatttg
tacttcttcgacggaccttcttcgacggacgtcactaaagcgtatcaaaagtcggctatt
ggtctaccagcaatgcagcaatactggacttttggctttcatcaatgccgttggggttac
cgcaactggaccgagactagagaaatcgttgagaccatgagagctttcaacatcccaatg
gaaaccatatggctcgacattgactacatggatcagtaccgtgactttacgctggatccc
gtcactttccctccatctgaagtggccgacttctttggatggctgcatagaaacaatcag
catttcgtaccaattgttgatgcagctatttacattccaaacccgcagaatgcaagcgat
gcatatgacacatatacgcgcggcaatgaatctggtgtgttcttgtccaacccagacggc
agccaatatatcggtgctgtctggcctgggtataccgttttccctgattggttgtcgccc
aatggcgtatcttggtgggtgaaggagatggtcgagtggtacaaagaggtaccatatagt
ggtttctgggttgacatgactgaagtctcttctttctgcgtcggatcctgcggtaccggc
aacgtcaccctgaacccggctcatccgcccttctcgcttcctggtgaggtgaataatgtt
atctatgattacccggagagcttcaacatcacaaatggtaccgaggcggcgtccgcttct
gcagcagcttctgctcaagcttctaggaaggcaactgcgacggcgacggtgaccgacgaa
gtgacttctacttcgacaagctacttccgctcgacccctaccgctggggagcgaaacatc
aactatcctccttatgtcatcaatcacgtacaagatggcgctgatcttgctgttcatgct
gtcagccccaatgcaacccatacgaatggtgtggaggaatacgatgtccacaacctcttc
ggtcaccagatcatcaatgctacttatcaaggtctcatttcggtgtttcctgggaagcga
ccctttatcattggacgttccacatttgctggcagcggcaagtgggctggtcattggggt
ggtgacaatgcttctagatgggcctacatgttcttctcgattccacaagcactttccttt
tcattattcggtattccgatgtttggtgtcgatacctgcggattcaacggaaacactgac
atggagctttgctctcgatggatgcagctttcggccttttttcccttttaccgcaaccac
aacgtactctccgccattcctcaagagccctaccgatgggaggctgtggcttctgcttca
aggactgcaatgcacattcgctactctctgttgccgtacatgtacacgctattcaatgac
gctcacaagactggatcaactgtgatgcgcgcgctagcatgggagttccccaacgaaccc
caactcgctggtgtggatacacagttcttgcttgggccaaacatcctagtcacacctgtc
cttgagcctcaagtcgatactgtcaagggagtgtttcctggtattgttgacggcgagacg
tggtttgactggtattctggcgagcgtgttcaggctgaggctggtgtaaacacgactatc
tcagcacctttgggtcacatccctgtatacattcgcggaggttcagtcctacctatccag
gagcctggatacacgactaccgagtcccgtcagaacccctggggtctcattgtcgcactc
tccagcgaaggcggcgcatctggccacctatacattgacgatggcgaatccatcgagcca
gagtcgtgcctggatgttacgtttgctgctataagcggaaagttggaggttgatgttcaa
ggcgagttcaaggacaccaacgcactcgccaacgtgacagtgttgggagctccggaggtc
caacacgtcaagctgaatggtgaggccatagacgccagccatgtcgattacaacaagacc
agtggcgttttgaagctgacgggacttactgaattgacaagttccggagcttggcagggt
agctggacgctgacttgggaataa

DBGET integrated database retrieval system