KEGG   Bipolaris sorokiniana: COCSADRAFT_178113Help
Entry
COCSADRAFT_178113 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00020  Citrate cycle (TCA cycle)
bsc00310  Lysine degradation
bsc00380  Tryptophan metabolism
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
bsc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCSADRAFT_178113
  09105 Amino acid metabolism
   00310 Lysine degradation
    COCSADRAFT_178113
   00380 Tryptophan metabolism
    COCSADRAFT_178113
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     COCSADRAFT_178113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 19133122
NCBI-ProteinID: XP_007695899
JGI: Cocsa1_178113
UniProt: M2THP6
LinkDB All DBs
Position
Unknown
AA seq 1044 aa AA seqDB search
MLRNTLRQCSRKLPGSAPTRASFTTFAQPSRTAISTCRRPLALTHRRPYAVSAEETSKGV
DPNDSFLQGNTANYIDAMYMQWKHDPESVHYSWQVYFHNMESGDMPVSQAFQPPPTIMSS
PQGATARPGMGMANVEGTDIMNHLKVQLLVRAYQARGHHKAKIDPLGIRSEAESFGYNKP
RELELSHYNFTDKDLEQEIELGPGILPRFRTESRKKMKLKEIIDACERLYCGSYGIEYIH
IPDREQCDWLRERIEVPTPFKYSVDEKRRILDRLIWGTNFEAFLATKYPNDKRFGLEGGE
SLIPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAEANEEGS
GDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAILHYNNDEKEAVSAM
GVLLHGDAAFAAQGVVYETMGFHQLPSYHTGGTIHIVVNNQIGFTTDPRFSRSTPYCSDI
AKAIDAPVFHVNGDDVEAVNFVCQLAADFRAEFKKDVVIDMVCYRKQGHNETDQPFFTQP
LMYKKISQQPQTLDIYTKKLLEEKTFTKEDIDEHKAWVWGMLDESFNRSKDYVSNSREWL
TSAWNGFKTPKELATEVLPHLPTAIEEPQLKHIAKVIGEAPEDFNVHKNLKRILAGRTKT
VMDGQNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTYTPLQN
LSQDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQFIASG
EVKWLQRSGLVMSLPHGYDGQGPEHSSGRIERYLQLCNEDPRIFPSPEKLDRQHQDCNMQ
IAYTTKPSNLFHLLRRQMNRQFRKPLILFFSKSLLRHPIARSSIDEFTGDSHFQWIIEDP
AHASGEIESHEGINRVILCTGQVYAALVKEREARGEKDVAITRIEQLNPFPWQQLKDNLD
SYPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNQTEHHNRRHVMYAGRNPSASVATGLKV
SHKNEEKALLDMAFTVKQDKLKSE
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaacaccctgcgccagtgctctcgcaagctcccggggagcgccccaaccaga
gcatctttcaccaccttcgcacagccctcgagaacggccatctcgacatgtcgccgtcct
cttgcgcttacccaccgccgtccctatgccgtttcggcggaggagaccagcaagggcgtt
gaccccaacgactcgttcctccagggcaacacggcaaactacatcgatgccatgtacatg
cagtggaaacacgaccccgagagtgttcactactcatggcaggtctatttccacaacatg
gagtctggcgacatgcccgtgtcgcaagccttccagccgccgcccaccatcatgagctcg
ccccagggcgctacagccagaccgggtatgggtatggccaatgtcgaaggcacagacatc
atgaaccatctcaaggtccaattgctcgtccgcgcataccaggctcgtggccaccacaag
gccaagattgacccgctcggcattcgctcagaggctgagtcttttggctacaacaagccc
cgcgaactcgagctttcccactacaacttcaccgacaaggacttggagcaggaaattgag
ctcggcccgggtatcctcccccgcttcaggacagagtctcgcaagaagatgaaacttaag
gagatcatcgacgcctgcgagcgcctgtactgtggctcctacggaatagaatacattcac
atcccggacagggagcagtgcgattggctccgtgagcgcattgaggttcccacgccgttc
aagtactccgtcgatgagaagcgccgcatcctggaccgcctcatctggggcacaaacttc
gaagccttcttggctaccaaataccccaatgacaagcgattcggtcttgaaggtggcgaa
agtttgattcccggaatgaaggctttgattgaccgaagtgtcgattatggcgtcaaggat
atcgttattggtatgcctcatcgtggacgtctcaacgtgctctccaacgtcgtcaggaaa
cccaacgagtccattttcagtgaatttgccggtactgctgaggccaacgaagagggctct
ggtgatgtcaagtaccacttgggtatgaactttgagcgccccaccccgtctggaaagcgc
gtgcagctgtcccttgtcgccaacccgtcccatcttgaggccgaggaccccgttgtgctt
ggaaagacccgcgccattctgcactataacaacgacgagaaagaagctgttagtgccatg
ggtgttcttctgcacggtgacgccgcttttgctgcacagggtgtcgtctacgaaactatg
ggcttccaccagctgcccagctaccacactggcggaaccattcacattgttgtaaacaac
cagattggtttcaccactgatcctaggttttcgcgctctactccttactgctctgatatc
gccaaggccatcgatgcgcccgtcttccacgtcaacggcgatgatgttgaagccgtcaac
tttgtctgccagcttgccgccgacttccgcgctgagttcaagaaggacgtagtcatcgac
atggtttgctacaggaaacagggtcacaacgaaactgatcaacctttcttcactcagccc
ctcatgtacaagaagatctcgcaacaacctcagacactggacatctacaccaagaagctc
ctcgaggagaagactttcaccaaggaggacattgatgagcacaaggcttgggtctggggt
atgctagatgagagcttcaaccgcagcaaagactatgtttccaactcccgggagtggctc
acctctgcatggaacggcttcaagacaccaaaggagcttgctaccgaggtgttgcctcat
ttgccgactgccattgaagagccacagctgaagcacatcgccaaggtgatcggagaggca
ccagaggactttaacgtacacaagaacttgaagcgtatcttggctggtcgtaccaagacg
gtcatggatggccagaacatcgacatggctaccgccgaagcgttggcattcggaagtctg
tgcatggagggtcaccacgtccgtgtttctggacaggatgtggagcgtggaaccttctct
cagcgtcacgctgtccttcacgaccaggagacggagaagacatacactcccctgcaaaac
ctcagccaggaccaggcaacatttaccatttccaactcgtctctcagcgagtatggagtg
ctcggtttcgaatacggatactcactgtcatcgcccaatgcgcttgtcatgtgggaggcc
cagtttggtgactttgccaacactgctcaggtcatcatcgatcaattcattgcatcaggt
gaagtcaagtggcttcagcgttccggtctcgttatgagcttgccacatggttacgatggt
caaggtcctgagcactcttcgggtcgtattgagcgttacctgcagctatgcaatgaggac
ccacgcatcttcccatcgccggagaagcttgatcgccagcaccaggactgcaacatgcag
attgcctacaccacgaagccatccaacttgttccatcttctccgtcgccagatgaaccgc
cagttccgcaagccgctcatcctgttcttctccaagtcgctccttcgccacccaattgcg
cgctcgagcattgacgagttcactggagactcgcacttccagtggatcattgaggacccc
gcacatgccagcggagagattgaatcgcacgagggcatcaaccgcgtcattctctgcact
ggtcaggtttacgctgcgcttgtcaaggagcgtgaggcacgtggagagaaggatgtggcg
attacccgcatcgagcagctcaacccgttcccatggcagcagctcaaggacaacctcgac
tcataccccaatgcacagaacattatctggtgtcaagaggagccgctcaacgcaggagct
tggagcttcacacagcctaggattgagactctgctcaaccagacggagcaccacaacagg
agacacgtcatgtacgctggacgcaaccctagtgcatctgtagcgactggactcaaggta
tcgcacaagaacgaggagaaggcgctgctggatatggccttcacggtcaagcaagataag
ctgaagagcgagtaa

DBGET integrated database retrieval system