KEGG   Bipolaris sorokiniana: COCSADRAFT_195126Help
Entry
COCSADRAFT_195126 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00250  Alanine, aspartate and glutamate metabolism
bsc00410  beta-Alanine metabolism
bsc00430  Taurine and hypotaurine metabolism
bsc00650  Butanoate metabolism
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
Module
bsc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    COCSADRAFT_195126
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCSADRAFT_195126
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCSADRAFT_195126
   00430 Taurine and hypotaurine metabolism
    COCSADRAFT_195126
Enzymes [BR:bsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     COCSADRAFT_195126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19133920
NCBI-ProteinID: XP_007694659
JGI: Cocsa1_195126
UniProt: M2T4C7
LinkDB All DBs
Position
Unknown
AA seq 549 aa AA seqDB search
MAGLARHVDTEELLTTLKDHPMHKAGGRHAENRATSHITPYSSRYAAGNELSKFKIPQDG
APADVVHQLLKDELDLDGRPSLNLASFVGTYMEREGEQLMIENISKNLSDADEYPAMMDM
HARCVSIIAHMWGVQKGEKAIGSATTGSSEAIHLGGLAMKRRWQEKRRAEGKDTSNPNII
MGANAQVALEKFARYFEVEARILPVSEDSSYRLDPKLVKENIDENTIGVFVILGSTYTGH
YEPVEEISEILDEFEKKTGVDIPIHVDAASGGFIAPFTHAKAGRKWNFELPRVKSINTSG
HKFGLVYAGVGWIIWRDESYLPKHLIFELHYLGGTEESYTLNFSRPGAQVIAQYYNLIHL
GFSGYRSIMENTLANARLLSRALEHTGWYRCVSDIHRKKGDFKYEKGKEQYEEGATSEAY
NPGLPVVAFTLTDGFHKEFPHVKQEAVSNLLRAKQYIIPNYPLPPNEEKTEILRVVVRES
LSIDMIDRLVTDICGVTEMLMNTDAVDLAAFQPSANPSVEKQHASKGLRKEHKHKAQRPT
KDGVYRTVC
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcaggactagcaagacacgttgacacggaagagctcttaacgacgctcaaagaccat
cctatgcacaaggctggcggacgtcatgccgaaaaccgagcaacttcgcacatcacccct
tactccagtcgatatgctgctggcaacgaactgtccaagtttaaaattccacaagacggt
gccccagccgatgttgttcaccagctactcaaagatgagctcgacctagacggacggcct
agccttaaccttgcttcattcgttggcacctacatggagagagagggcgagcagctcatg
attgaaaacatatcaaagaatctgtcagatgctgatgagtatccggccatgatggacatg
catgctcgctgtgtatccatcattgcccacatgtggggtgtgcaaaagggcgaaaaggca
attggatctgccaccactggctccagtgaggccattcatctcggtggactcgctatgaag
cgccgctggcaggaaaagagaagggcagagggcaaggacacttccaacccaaacatcatc
atgggtgccaatgctcaggtagcactggagaagtttgccaggtactttgaggtcgaggcc
cgtattcttcctgtaagcgaggattcgtcctaccgcctagaccccaagctagtcaaggag
aatatcgacgagaacactatcggagttttcgtcatcctcggctccacctacaccggtcat
tatgagcctgttgaagagatttcggaaatcttggacgaattcgagaagaagactggagtc
gacattccaatccacgtcgacgccgcatcaggtggcttcattgccccctttacacatgca
aaggcgggcaggaaatggaatttcgagttgccgcgagtgaagtccataaacaccagtggg
cataaatttggacttgtgtatgccggtgttggatggatcatatggcgagatgagagctat
ttacccaagcatttgatatttgaactccactacctgggcggaaccgaggagtcgtacacg
ttgaacttctcacgaccaggtgcgcaggtcattgcgcagtactataacctgattcatctg
ggtttctcgggataccgcagcattatggaaaacaccttggctaatgcccgtctattgagc
agggcgctggaacacacgggctggtaccgctgcgttagcgacattcaccgcaaaaagggt
gacttcaagtacgaaaagggcaaggagcaatacgaagaaggcgctacgagcgaagcttac
aaccctggtctacccgtcgtagcctttacccttaccgatggcttccacaaagaattcccg
cacgtcaagcaagaagccgttagcaatctgctccgtgctaagcaatacattattcccaac
tacccgcttccccccaacgaggagaagactgagattctgagagtagtagtcagagagtct
ctctcgatcgacatgatcgacaggcttgtgactgacatctgcggcgtgacagaaatgctt
atgaatacggatgccgttgaccttgcggcgttccaaccaagcgccaatcctagcgtcgag
aaacagcatgcgagcaagggcttgaggaaggaacacaagcacaaggctcagcggccgaca
aaagatggcgtctaccgaacggtgtgttag

DBGET integrated database retrieval system