KEGG   Bipolaris sorokiniana: COCSADRAFT_205954Help
Entry
COCSADRAFT_205954 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
Organism
bsc  Bipolaris sorokiniana
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NAD_binding_7 ADH_zinc_N_2 TrkA_N Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 19134316
NCBI-ProteinID: XP_007694505
JGI: Cocsa1_205954
UniProt: M2RR69
LinkDB All DBs
Position
Unknown
AA seq 368 aa AA seqDB search
MSAPNPAQSTQETMNALRFHGQKDLRFEKIPIPEVKPGQVKIKPAWVGICGSDLHEYLGG
PNLCPTTPHPITGETVPLTFGHEFSGTIEEVGEGVADYKPGDRVVIQPIIYDDTCVACEE
GLHNCCWSNGFIGLSGWGGGLADHIVVPTSTLYHLPDNVPLDIGALVEPLAVGWHAVKAS
PYKKGDSVLVLGGGPIGIATILALKANGCGKIIVSEISKKRQEFARNFGAHYIINPVNED
LATRCRELTGGKGVHVVYDCAGVQSALNQAVHATRARGCIVNIAIWEKPCTIQTNDFNFK
ERSYMGIATYEVGDFQEVIDALSRGDMDPKAMITQKIALTEVEEKGFKSLINDKDNQVKI
LVEVGGGV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctccaaacccggctcagtccacacaggagaccatgaacgcgctgcggttccac
ggccaaaaggacctaagatttgagaagatcccaatcccagaagtcaagccaggtcaagtc
aagataaaaccagcatgggtcggaatctgtggcagtgacctccacgagtatttaggtggt
ccaaacctctgtcccaccacacctcatccaatcaccggcgaaacagtcccacttaccttt
ggccacgagtttagcggaacaatagaagaggttggcgagggcgtagcagactataagcct
ggcgacagggttgttattcagcccattatatacgacgacacctgtgtcgcgtgcgaagag
ggattgcataactgctgttggtccaatggcttcatcggcctatctggatggggtggtggg
ttagcagatcacatagtcgtcccaacatcgactctataccaccttcccgacaatgtcccg
ctcgatattggcgccctagtcgagcctctagctgttggctggcacgctgtcaaagccagt
ccctacaagaaaggcgatagcgtgctcgttttgggaggcggccccattggaatcgcaact
attctcgccctcaaggcaaacgggtgtggcaagattattgtctcggaaatcagcaaaaag
agacaagagtttgccaggaactttggcgcacactacatcatcaaccccgtgaacgaagac
ctcgcaacccgctgtcgcgaacttacaggggggaaaggtgtgcacgtagtttatgattgt
gctggtgtccaatcagcactcaatcaggccgttcatgccacacgagctcgcggctgcatt
gtcaacatcgccatttgggagaagccatgcacgatccagaccaacgacttcaacttcaag
gagcgaagctacatgggtattgcaacgtacgaagtgggtgacttccaagaagtgattgac
gcacttagtcggggcgatatggacccaaaggccatgattacacagaagattgctctgacc
gaggtggaggaaaagggtttcaagagtctgatcaacgacaaggataaccaggttaagatt
ctggtcgaagttggtggtggcgtatga

DBGET integrated database retrieval system