KEGG   Bipolaris sorokiniana: COCSADRAFT_243297Help
Entry
COCSADRAFT_243297 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    COCSADRAFT_243297
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsc03400]
    COCSADRAFT_243297
Enzymes [BR:bsc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     COCSADRAFT_243297
DNA repair and recombination proteins [BR:bsc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     COCSADRAFT_243297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C LIG3_BRCT BRCT Complex1_49kDa Bac_globin
Motif
Other DBs
NCBI-GeneID: 19135050
NCBI-ProteinID: XP_007703812
JGI: Cocsa1_243297
UniProt: M2RZI9
LinkDB All DBs
Position
Unknown
AA seq 994 aa AA seqDB search
MAEDTPMLDADAVRENTLMYGHDDDLDEKYPMRPLNLHKTLPFHTLFTDLFNPLMDTQKK
KQPVGPRRKVGPHGRGSLTPHEAKRNIVERFIANWRKQVGNDFYPAMRLIIPEKDRDRAM
YGLKEKAIAKVLIKLTRIGKDSDDAKHMLNWKLPSQLQKASAWTAGDFAGRCYEILSSRQ
LKTEYSDMSIAEVNNALDKLSQVGTEEEQVKIFQRFYRRMNAEEMTWLIRMILRQMKIGA
TEKTLLDIWHPDAETLFNVSSNLRRVCWELFDHNIRLEGENTGLCLMQCFQPQLAQFQDK
VGSFQKMVNRFKGDSDEDTFWIEEKLDGERMQLHMVEDPDAPGGKSFGFWSRKAKDYTYL
YGKHFHGDAAGALTRFITDAFGKNVKNIILDGEMVTWDMETDHIVGFGTLKTAAISEKEN
KTNQETGQRPLFRVFDCVYLNDTLLTQYTLRDRRRALESAVKGVHRRLEVHPYIEARSHT
EIEPALRKVVAEASEGLVLKNPRSMYCLNQRNNDWMKVKPEYMSEFGESLDCIVVGGYFG
SGRRGGAHSSFLCALLTNKSAKPGDPKHEHCWSFFKVGGGFSSDDYAALRGRTQGKWHDW
DPRRPPPFIELGGHEQNRQHERPDQWIRPSDSVVLECKAASVESSDKFRFALTLRFPRFK
QLRTDKRWDQALSVQEFLEVKTKVEIEKSEKEKEFKIEQSRRKRARTSKKPLAVMGNDTT
TTPYAGPKSKIFDALSFYVMTEQMHPVKKSKADLEALIKANGGRLVQRDSTDKNLIIIAD
KRLIKVASLEKRATNNIVKPIWIQDCITQNEADTGALPYLLPFEPNRHMLYLHDDDQFEF
ESNVDENGDSYARDIADVEEMRKFLDGMAKPESPATFQRHDFLKQLEDHGKPLEQLKTHM
FHSVKAVFSYDGDNKEWSLRAQLAKNYFRFGDGLIADNEEEEEGVTHVIVPDEKSLSKRG
NPRISGLARIVGIGWVEKCWEEGTRLDEERFQWG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagatacgccaatgctggatgccgacgccgtacgtgagaataccctcatgtat
ggccatgatgacgaccttgatgagaaatacccaatgcggccattgaatttacacaagaca
ctgccgtttcacacattattcaccgatcttttcaatccgctcatggacacgcaaaaaaag
aagcaaccggtcggccctcggcgcaaggttggaccgcacggccgcggcagcctaacgcct
catgaagccaagcggaacatcgtcgagcgctttattgcgaattggcggaagcaggtgggg
aatgacttctaccctgcaatgcgcctcattattcccgagaaagaccgagaccgggccatg
tacggcctaaaggagaaggcaatagcaaaggtcttgatcaagctcaccagaattggcaag
gattcagatgatgcaaaacacatgctcaactggaaattgcctagtcagctgcaaaaagca
tcagcttggactgctggtgactttgccggacggtgttatgagatcctgtcgtcacggcaa
ctcaagacagagtacagcgacatgagcattgcagaagtcaacaatgctctcgacaaacta
tcgcaagtcggtacagaagaagagcaagtcaaaattttccagagattttaccggaggatg
aatgcagaggaaatgacatggctgatccggatgattcttcgtcagatgaagattggtgca
actgagaagaccttgcttgatatttggcatccagatgcagaaacgctattcaatgtgtcg
tcgaatcttcggcgtgtttgttgggagctttttgatcacaacatacgtctcgagggcgag
aatactggcctttgtctcatgcaatgctttcaaccgcaactagctcaatttcaggacaaa
gtaggctcgttccagaagatggttaacaggttcaaaggagattcagatgaagatacattc
tggattgaggagaaactcgacggcgaacgcatgcaactacatatggtagaggatccagat
gcgccaggtgggaaatcgtttggcttctggtcgcgaaaggcgaaagactacacttatctc
tatggaaagcatttccacggcgacgcagctggagcactaacgcggttcataacagacgca
tttgggaagaacgtgaagaacattatcctcgacggcgaaatggttacctgggacatggaa
actgatcacattgtcggttttggtactctcaagacggcagccatatccgagaaggagaac
aaaacaaaccaagagactggccagcgaccgctgtttcgagtgtttgactgtgtgtacctg
aacgatacgttgctcacccagtatacgcttcgtgatcgccgtcgtgctctggaaagcgct
gtcaaaggtgtacatcgcagattagaagttcatccatacattgaggctcgttcacatact
gagatcgagccggcgctgcgaaaagtggttgctgaagcatccgagggcttggtgttgaag
aaccctcgctcgatgtattgcttgaaccaacgaaataacgattggatgaaggtgaagccg
gagtacatgtccgagtttggagagtctcttgactgcattgtcgttggagggtactttggc
tctggtcgtcgcggtggtgcccactcatctttcctctgtgcgctacttacgaacaagagc
gcaaagccaggagaccccaaacacgaacattgttggtcattcttcaaggttggtggtgga
ttcagctcggacgactacgctgctttacgaggacgaacgcaaggaaaatggcatgactgg
gatcctcggcgtccaccgccattcatcgaactaggtggccacgagcagaatcggcaacat
gagagaccggaccaatggattagaccaagcgattctgtcgtactggagtgcaaagccgcc
agtgtcgagagcagtgacaagttccgctttgcattgacactccgctttccacgctttaaa
cagctcaggacagacaaacgatgggatcaggcgctttccgtgcaggagttcctcgaagtc
aaaaccaaagtagagatcgagaaatctgagaaggaaaaggaattcaagatcgaacagtca
cggcgcaagagggcacgcacatcaaagaagccgctggcggtgatgggtaacgatacgacg
acgacaccttatgcaggcccaaagtctaaaatcttcgacgcactcagcttctatgtcatg
actgagcagatgcacccagtgaagaaatccaaagctgacctagaggcactcatcaaagcc
aacggtggtaggcttgtccaacgcgactctacagacaagaatctcatcatcattgccgac
aaacggctgatcaaagtcgcgtctctggaaaagcgagctacaaacaacatcgtcaagccg
atctggatccaagactgtattacgcaaaacgaagcagacactggcgcattgccctaccta
cttccttttgaaccgaacaggcacatgctttacctccacgatgacgatcaattcgaattt
gagagcaacgtagacgagaatggcgattcttacgcacgcgacattgcggacgtagaagag
atgaggaaatttctggatgggatggcgaaaccggaaagtccagctacgttccagcgacac
gactttttgaaacagctggaagatcatggcaagcctctggagcagctgaagacccatatg
tttcactctgtcaaggctgtattctcgtatgacggagataataaagaatggtctctgagg
gcgcagctggcgaagaactatttccgttttggagatgggctgattgctgataatgaggaa
gaggaagaaggggtcacgcacgtcattgtgccagacgagaaatctttgtcgaagagaggg
aatccgagaatctctggacttgctcgaatagttggtataggatgggtggaaaagtgctgg
gaagaaggcacaaggttggatgaagagagattccaatggggctag

DBGET integrated database retrieval system