KEGG   Bipolaris sorokiniana: COCSADRAFT_276134Help
Entry
COCSADRAFT_276134 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
bsc  Bipolaris sorokiniana
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsc01001]
    COCSADRAFT_276134
Enzymes [BR:bsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     COCSADRAFT_276134
Protein kinases [BR:bsc01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   COCSADRAFT_276134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 19135716
NCBI-ProteinID: XP_007696258
JGI: Cocsa1_276134
UniProt: M2RQ81
LinkDB All DBs
Position
Unknown
AA seq 399 aa AA seqDB search
MATKTSNGGSGGAQALQTPQVQPCRYKTGKTLGAGSYSVVKECVHIDTGRYYAAKVINKR
LMAGREHMVRNEIAVLKRVSMGHRNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGN
YYESDAGDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEE
QFHVLTTTCGTPGYMAPEIFRKTGHGKPVDIWAIGVITYFLLCGYTPFDRDSNLEEMQAI
LVADYSFTPLEYWRGVSLTAREFIRRCLTVDPAARMTAHEALSHPWITELGKNNADGEED
LLPTVKKNFNARRTLHAAIDTIRAINQLRAGGAAGMMDGQRSAEPRRGAPHARIPQPAEE
PDDPMEIDSRGNGHGQTEEMIQEQERRIRETQQGLWGKR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaagacttccaacggtgggtctgggggggcacaggcactacaaacaccccag
gttcagccttgcagatacaagacgggcaagactctgggtgcgggcagttactcggtcgtc
aaggagtgtgtgcacatcgatacagggcgatactatgccgcaaaggtcatcaacaagagg
cttatggctggccgagaacatatggtcaggaacgagattgcagtattgaagagagtttcc
atgggtcacagaaacatcctcacgctcgtcgactactttgagacgatgaacaacctctat
ttggtcaccgaccttgcgcttggaggcgagctcttcgaccgcatctgtcgtaaggggaac
tactacgaatccgatgccggcgacctgatcagggctactctatcggcagtcgcatatctc
cacgaccacggtatcgtgcaccgagatttgaagccagagaacttgctgttccgaacacca
gaggacaatgctgatttgcttatcgccgattttggactttctcgaatcatggacgaggag
caatttcacgtcctcacaacaacctgcggtacgccaggctacatggcgcctgagattttc
agaaagacaggtcatggcaagccagtcgacatttgggccattggtgttattacgtatttc
ctcctctgtggctacacccccttcgaccgcgactcgaaccttgaagagatgcaggccatc
ttggttgccgactattcttttacccctctggaatactggcgaggcgtctcacttacggcg
cgcgagtttattcgtcgttgcttgaccgtcgatcctgcagcgcgcatgaccgctcacgag
gctctctcccatccctggatcactgagctcggcaagaacaatgctgatggcgaagaggat
ctgctgccaactgtcaagaagaactttaatgctaggcgcacgcttcacgctgctattgac
acgatccgcgctatcaaccaactccgagctggtggcgctgcgggtatgatggacggtcag
cgatcagcggaaccccgacgaggggcgccccacgcgcgtattccccaaccggcagaggag
cccgacgacccgatggagattgacagcaggggaaatggccacggtcagaccgaagagatg
atccaggaacaagagcggagaatcagggagacacagcagggattgtggggaaagcgctga

DBGET integrated database retrieval system