KEGG   Bipolaris sorokiniana: COCSADRAFT_32229Help
Entry
COCSADRAFT_32229  CDS       T03124                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00500  Starch and sucrose metabolism
bsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCSADRAFT_32229
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     COCSADRAFT_32229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 19136694
NCBI-ProteinID: XP_007694236
JGI: Cocsa1_32229
UniProt: M2SQK6
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MLPRVFLLTGFVHHAYTLSIPRLPSLATFAASSRVQQQQPLQDTLDAWIKHEERIALDKL
LANVAPGGSNVQGKGVAEGTVIASPSQDGPDYWFQWVRDAAITMDTLVNIYADDPSSSRA
SSLSIILDAYTSLQGDIQRTSNPSGTFDDLSGLGEPKFQVDGKPFTGSWGRPQRDGPALR
ALTLMHYLREYNASHPSLWSSPDSEDFFGSFYTAEMPPRSIIKADLEYVSHFWNQSGFDL
WEEVEGLHFFTLMVSARSLKEGSHLARTFGDFGAADWYQKQAGYIENLLGKFWNAQKGQL
VETLWSKRSGLDCGLLLGSLHALPKSQSEDDVVYPPWSDEILVSLLALTRDQRDRFPINS
NPSDQDDDDDNVDEFTFQGTGLGRYPEDVYDGYGNSNRGGNPWFLCTSSAAEILYRTASH
ISATGNLTVTDVGLPFYESLLGSSSLDVDVGTFGPTDALFHSVIERLQSTGDEFLQVVKT
HVDAEGSMSEQFDRVTGYMRGAQHLTWSYGAFLQAARARKISVH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctccctcgcgtgttcctcctcacaggcttcgtccaccatgcctacacactatcaata
cctcgtcttccctccctggccacttttgccgcttccagtcgtgtgcagcaacaacaaccg
ctccaagacacacttgatgcctggataaagcatgaagagcgcattgcactggacaaactg
ctcgccaacgttgcgcctggaggtagcaatgtccaagggaaaggtgtggctgagggcact
gtcattgccagccccagtcaagacggtccggactactggttccaatgggtccgtgacgct
gctatcaccatggataccctcgtcaacatatatgccgatgatccctcgtcctcgcgcgcg
tcttctctatccatcatcctagatgcatatacctccctccaaggtgacatccagcgcacc
tcaaacccgtctggcacatttgacgacctttccgggctaggtgagcccaagttccaagtc
gatggcaagccattcaccggctcgtggggacgacctcagcgcgatgggccggcccttcgc
gcactgacgctcatgcactatctacgcgagtacaacgcatcccatccctcactatggagc
tctcctgactccgaagacttttttggttcattctacactgctgaaatgccccctcgtagc
atcatcaaagcagatctcgagtatgtcagccatttctggaaccagtcgggattcgatctc
tgggaagaggtcgagggcctgcacttcttcaccctcatggtcagcgcgaggagtctgaag
gaaggcagtcaccttgccagaacctttggagattttggtgcggcggactggtaccaaaag
caagctgggtatattgagaacctgttgggcaaattctggaatgcgcaaaaaggacaactt
gttgagacgctatggagcaagaggagtggcctcgactgcgggctgcttctcggctctttg
cacgcccttcctaagagccaatctgaagatgatgtcgtgtatcctccgtggtctgacgag
attcttgtttctctacttgctttgactcgggaccagcgcgaccgcttccccatcaacagc
aatccctctgatcaggatgacgatgatgacaatgtagacgaattcacgttccagggaacg
ggccttggccgttatcccgaagatgtatacgatggctatggaaactcgaatcgtggtgga
aacccatggtttctgtgcacctcttccgccgctgagattttgtaccgaactgcctcgcac
atctctgccaccggcaacttgactgttaccgatgtcggccttcccttttacgagtctctc
ctcggtagctcgtcactagatgtcgacgttggcacttttggccccacagacgccctcttt
cactccgtcatcgagcgccttcagagcaccggtgacgagttcctccaagtagtcaagacg
catgtggatgctgagggaagcatgagtgagcagtttgaccgtgtgactgggtacatgcgt
ggtgctcagcatttgacttggagttatggtgcgtttttgcaggctgctagagcgagaaag
atttctgtgcattag

DBGET integrated database retrieval system