KEGG   Bipolaris sorokiniana: COCSADRAFT_328020Help
Entry
COCSADRAFT_328020 CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00010  Glycolysis / Gluconeogenesis
bsc00051  Fructose and mannose metabolism
bsc00052  Galactose metabolism
bsc00500  Starch and sucrose metabolism
bsc00520  Amino sugar and nucleotide sugar metabolism
bsc01100  Metabolic pathways
bsc01110  Biosynthesis of secondary metabolites
bsc01130  Biosynthesis of antibiotics
bsc01200  Carbon metabolism
Module
bsc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCSADRAFT_328020
   00051 Fructose and mannose metabolism
    COCSADRAFT_328020
   00052 Galactose metabolism
    COCSADRAFT_328020
   00500 Starch and sucrose metabolism
    COCSADRAFT_328020
   00520 Amino sugar and nucleotide sugar metabolism
    COCSADRAFT_328020
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    COCSADRAFT_328020
Enzymes [BR:bsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     COCSADRAFT_328020
Membrane trafficking [BR:bsc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    COCSADRAFT_328020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 19136905
NCBI-ProteinID: XP_007700557
JGI: Cocsa1_328020
UniProt: M2T2L0
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MTIVLGSMADMPRDLKEQIEKLEEHFVVSTEKLKHISDHFVKELEKGLSEQGGSIPMIPT
WCMAFPDGNETGKYLALDMGGTNLRVCEVTLTEEKGEFEIIQSKYRMPEELKTGTADELW
GYVADCLQQFIEYHHEGEQLADLPLGFTFSYPVSQDAIDHGVLQRWTKGFDVQGMEGVDV
VPGFKAALEERGVPIKLAALVNDTTGTMIASAYTDTSIKIGCIFGTGCNAAYMEECGAIP
KLKHMNLDPKLPMAINCEWGAFDNEHQVLPRTKYDVIIDKESPRPGQQTFEKMVAGLYLG
EIFRLVLLDLHKGSECSMFEGQNASKLDKPYSLDAGFLSQIEEDRFENLQDTADLFQETL
GITCTKPELELIRRLAELIGTRAARLTACGVSAICKHKKWSEVHVGADGSVFSKYPHFKI
RQAQALKEIMDWPAKYGKGKNDPIEVLPAEDGSGVGAALIAALTVKRAQQGQLAGISDQD
ALLAMGKTSKK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgtgctaggctccatggcggacatgccccgggatctgaaggagcagattgag
aagctggaggagcactttgttgtctccacggaaaagctcaagcacatctcggatcacttt
gttaaagagctcgagaagggactatcagagcaaggcggaagcattcctatgattccgacc
tggtgcatggcctttcccgatggcaacgagaccggaaaataccttgcgcttgacatgggc
ggtacgaacctacgtgtttgtgaggttaccctgacggaagagaagggagagtttgagatt
atacaatcaaagtaccgtatgcctgaggagctgaagactggaactgctgatgagctatgg
ggctacgttgccgactgcctccagcaattcatcgagtaccaccacgagggcgagcagctc
gccgatctgcccctcggtttcaccttctcgtaccctgtctcccaagatgctattgaccac
ggtgtcctacagcgatggaccaagggattcgacgtacaaggcatggagggtgtagacgtt
gtgcctggattcaaggcagctctggaggaacgcggcgtgcctatcaagctcgcggcactg
gtcaacgacaccactggcaccatgattgcctcagcatatactgataccagcatcaagatt
ggttgcatcttcggtacggggtgcaacgctgcctacatggaggagtgtggtgctattccc
aagctgaagcacatgaacctggacccaaaactgccaatggctatcaactgcgaatggggc
gcctttgacaacgaacaccaagttctgccacggacaaaatacgacgttataattgacaag
gagtcgcctcggccgggtcaacagacttttgaaaagatggttgcaggtttgtaccttggc
gagatcttccgtctagtcctcttggatcttcacaagggttcagaatgctccatgttcgaa
ggccagaatgccagcaaactcgacaagccttactctcttgatgctggtttcctctcccaa
atcgaagaagaccgcttcgagaatttgcaagatacggccgatctgtttcaggagacgctt
ggtatcacctgcactaagcctgaactcgagctaatccgccgacttgctgagctgattggt
acccgcgctgctcgtctgactgcctgcggtgtctccgctatctgcaagcacaagaaatgg
agcgaggtgcatgttggcgctgacggttccgtattcagcaagtaccctcacttcaagatc
cgtcaggctcaggcactgaaggaaatcatggactggccagccaagtatggaaaaggcaag
aacgatcctattgaggtgttacctgccgaggacggttccggtgttggtgctgcgctcatt
gctgcgcttacggtcaagcgtgcgcaacaaggacaactggctggtatcagtgaccaggat
gcgctgcttgctatgggaaagaccagcaagaaatag

DBGET integrated database retrieval system