KEGG   Bipolaris sorokiniana: COCSADRAFT_36051Help
Entry
COCSADRAFT_36051  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
bsc  Bipolaris sorokiniana
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsc03036]
    COCSADRAFT_36051
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     COCSADRAFT_36051
Chromosome and associated proteins [BR:bsc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     COCSADRAFT_36051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 19138648
NCBI-ProteinID: XP_007699085
JGI: Cocsa1_36051
UniProt: M2RCZ8
LinkDB All DBs
Position
Unknown
AA seq 1192 aa AA seqDB search
MQSQRQSSPAAAPSPPRPARQTTTNNDTNLLSHPLKRRSLQTATTNMPLPQPQPQPQPHS
SAVLNPTPPRRAPSTPNFKATPSIQRSPSVASFRSSTPGLTRKSSTSSLRGDAPRASVSR
RASFNPMMQSPMPKSPLATSCHQDKPPLRACDVALDFFKKELARHEGITGAVNAGTVVIV
HDQCYGHRFSRPKTAKSTLSLIMERPERILASVLGISTAYVRLGERHADGSHPPHPHHNP
PDRVPFKIRKTSRAVDITSPVVTNVHGTKWMNELKSLCDDAERKLASTGKELARDSPAVL
GQASKELHAGDLYLCPESLDAFQGALGGVLDAVDAVFQGTSSGEGPSRAFVCIRPPGHHC
SDDFPSGFCWINNVHVGIEHAIMTYNLTHAAIIDFDLHHGDGSQAITWARNKRVHNMSKN
TPNWKKTSIGYFSLHDINSYPCEDGDDDKVQAASLCIDNAHGQSIWNVHLQPWKTVEQFW
AIYEEKYMVLLEKTRQYLKHHTNRLRTSPNHPAPKAAIFLSAGFDASEWETAGMQRHSVN
VPTEFYARFTRDVIRLAEEEGTSVQGRVISVLEGGYSDRALTSGVMSHLSGLVDGQVWTD
AKLATGLASSVRDRLSALSVDDQQVLTQSVETEATPLGYDPFWWHSTHLTELENLVNPAP
LTAPKKPPPGPNAHFSSPTQSFVAKVVDPSKLTRNLSAKYASSPSRAPTPPPPEVDWATA
AQALSSLLIPTDRQTRSHKPEDLMEVKAKKEKPAPPALTSVHVDKSGRQLRGRKAVPSYA
ERSSGDEKSHHKESRASRRQTIADFAPASSEVPPVPSASRRMSIASSVSSIGDRRSSSRE
PNVATSRRAVASSAAPVNEVGLKKVRGQTAAAAARAAQRPSAPRAQSNYSSTNIALKGRE
NDDVEALTSGLKRITLKMPSKEEHDAREKEREEKLKVAEAPKKSGTRKTPAARAAPAKPA
AKAMGTAKKGTGRAVKSSKVTSPQESKAPTPVPEDPYVQATAAATLRQPQPVSSQYASGL
VQNGTLQSPDGTEVPDESLRVDRRISGGIVQPPTELHDMAITPEQIREHLPMPSFVTVTE
PLTNASPPPRADTPPPPPPTSMPQFVNYTTESFGTAPSFAAPSNVSDPQASATLQWVANT
HAETTDMAAIAPMSPPSKRSDLPVFTANGAIPFASSSDVLGQTATGTGAKNG
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccaacgacagtcaagccccgctgcagcgccatccccgccgcggccagccagg
caaacgacaacaaataatgacacgaacctcctttcacacccgctgaagcgccgctccctg
caaacagccaccaccaacatgccgctcccccagccgcagccgcagcctcagccgcactcg
tctgccgtcctcaaccccaccccaccccgccgtgcgccctcgacgcccaacttcaaggct
accccctcgatccaacgcagccccagcgtagccagcttccgctcctcgacgccgggcctc
acccgaaaatcgtccacttcatctctacgcggcgacgcccctcgggcttctgtctcgcgc
cgcgcgtccttcaaccccatgatgcagtcgccaatgccaaagagcccactggctacctcg
tgtcaccaagacaagccgccgctgcgcgcctgtgatgttgccctcgacttcttcaaaaag
gaattggcccgccacgagggcatcaccggcgccgtcaacgcgggcaccgtcgtcattgtg
cacgaccaatgctacggccaccgcttctccaggcccaagacggccaagagcaccctcagc
ctcatcatggagcggccagagaggatcttggccagtgtcttgggtatatcgacagcctat
gtccggctgggagagcgacacgcagacggcagccacccgccccatccacaccacaacccc
ccggaccgcgtcccatttaagatccgcaagacctcacgcgctgtcgacatcacatcgcct
gtcgttaccaacgtacacggtacaaagtggatgaatgagctcaagtccttgtgcgacgac
gccgagaggaagctggcctcgacaggcaaggagctagctcgggattcgcctgcggtttta
ggacaggcgtcgaaggagctgcatgctggagacctttacctatgtcccgagtccttggat
gcctttcagggtgcgctcgggggtgtcctggatgccgttgatgccgtcttccagggtaca
agctcaggcgaggggccttcacgggcttttgtctgtattcgtcctccaggtcaccattgc
tccgacgacttcccctctggtttctgctggatcaacaatgtacatgtcggcattgagcac
gccatcatgacgtacaacctcacccacgccgccatcatcgactttgacctacaccatgga
gacgggtcgcaggcaattacctgggcccgaaacaaaagggtacacaacatgtccaagaat
acacccaactggaagaagacatcgattggctactttagcttgcatgatatcaactcatat
ccctgcgaagacggtgatgacgacaaggtccaggccgccagcttgtgtatcgacaacgcg
cacggccagtccatctggaatgtgcatttgcagccctggaagactgtggaacaattctgg
gccatctacgaagaaaagtacatggtactactcgagaagacacggcaatatctcaagcat
cacaccaaccgtctgcgaacttcaccgaaccatccggcacccaaggctgccatcttccta
tctgccgggttcgacgcaagcgaatgggagactgcaggtatgcagcgtcattctgtcaac
gtacctaccgaattctacgcccgcttcactcgtgatgttattcgtctggctgaggaggag
ggcacatctgtccaaggtcgcgtcatctccgttcttgaaggtggttatagcgaccgagcg
ctcactagtggagtcatgagccatctcagtggtcttgtagatggccaagtgtggaccgat
gccaagctcgcaacaggccttgcgtcctctgtgcgcgatcgacttagtgccctcagtgtc
gacgatcagcaagtcttgacgcagtctgtagagacggaagctacgcctctagggtatgat
cctttttggtggcactcgacccatctaacagaactcgaaaatcttgtcaatcctgctccc
ttgactgctccaaagaagccgccccctggacctaatgctcacttctcatcgcctacgcag
tcattcgttgccaaagtcgttgatccctccaagcttacccgtaacctctctgccaaatat
gcctccagcccctcgagagcgcccacacctcctccaccagaggttgattgggccactgct
gcccaagctctcagcagtctgttgattcctactgatcgacagacgcgtagccacaagcca
gaagatctgatggaagtaaaagcaaagaaagagaaaccggctccgccagcactgacgtct
gtacatgtggacaagtcagggcggcagttgcgtggccgcaaagctgtgccttcatacgct
gagcgtagctcgggagacgagaagtcgcatcacaaggagtctcgagccagtaggaggcaa
accattgctgactttgctccagccagctccgaggttccgccggtgccttctgcctcacgt
cgcatgagtattgcctcaagtgtgtcttcaataggagaccgtagaagttcgagtcgtgag
cccaatgtagcaacgagtagaagagctgtggcttcctcagcagcacctgtcaatgaggtt
ggcctgaagaaagtacggggccagacagcagcggctgcagctcgcgctgctcagcgtcct
tctgcaccacgcgcgcaatcaaactactccagcacgaatatcgcactcaagggtagggag
aacgatgacgtcgaagcactgacctctggcctgaaacgcattacattgaaaatgccctca
aaggaggagcatgacgctcgtgaaaaagagagagaagaaaagctcaaagttgcagaagct
ccgaagaagagcgggacacgaaaaacgccagcggcccgcgcagctcctgccaagcccgca
gcgaaagcgatgggcactgctaaaaaaggcacgggacgggcagtaaaatcatccaaggtt
acctctccacaggaatcaaaggcacctacacctgtacctgaggatccctacgtgcaagct
actgctgccgcgactctgcggcagcctcagccggtttcatctcagtatgcatcgggactg
gtgcaaaatgggaccctacagtctcctgatggaaccgaagttccagatgagagcttgaga
gtcgaccgacggatttctggtggaatcgtgcagccaccgacagagctacacgacatggcc
ataaccccagagcagatccgtgagcacctgccaatgccatcgtttgttaccgtgacggaa
ccattgacaaacgcttccccacctcctcgcgccgacacaccaccgcctccaccgccaacg
agcatgcctcagtttgtcaattacacgactgagagttttggtaccgcgccgagttttgca
gcgccatcgaatgtgtctgacccgcaagcgtcggcaactttgcagtgggtggccaacaca
cacgccgagactacggacatggctgcgatagcacccatgtcacctccgagcaagcggagt
gatcttcctgtcttcacggcgaatggcgcaataccttttgcgtcgagctctgatgtacta
gggcaaacagctacgggcacaggggccaagaatggatag

DBGET integrated database retrieval system