KEGG   Bipolaris sorokiniana: COCSADRAFT_40163Help
Entry
COCSADRAFT_40163  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCSADRAFT_40163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsc02000]
    COCSADRAFT_40163
Enzymes [BR:bsc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     COCSADRAFT_40163
Transporters [BR:bsc02000]
 Other Transporters
  Pores ion channels [TC:1]
   COCSADRAFT_40163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 19139660
NCBI-ProteinID: XP_007703627
JGI: Cocsa1_40163
UniProt: M2SDG1
LinkDB All DBs
Position
Unknown
AA seq 253 aa AA seqDB search
MSQQSDITLYTTQTPNGIKISITLEELGLPYKVHKIEISKNTQKEDWFLAINPNGRIPAL
TDTFTDGKPINLFESGSIMQYLVERYDTEYKISFPKGTREWFEMNNWLFFQNAGVGPMQG
QANHFSRYAPEHIEYGVNRYQTETRRLYSVLDKHLASDNRPYLCGTKCTIADIAHYGWGA
AAGWAGVNLDKFPAVQAWLDRMEAREGVEKGRHVPDPHTMRELLKDKAKMAEQAAKSQAW
VQAGMKEDAEKQK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcaatctgatatcacgctttataccacgcagacgccgaatggcatcaagatc
tccattaccttggaggagctgggcctcccctacaaggtccacaagatcgaaatatccaaa
aacacccaaaaggaagactggttcctcgccatcaaccccaacggccgcatccccgcccta
accgacaccttcaccgacggcaaacccatcaacctcttcgaatccggcagcatcatgcaa
tacctcgtcgagcgctacgacaccgagtacaagattagtttccccaagggaacgcgcgag
tggttcgaaatgaacaattggttgttcttccaaaacgccggtgtaggtcctatgcaaggc
caggctaatcatttctcgcgttatgcccccgagcatatcgagtatggtgtgaacaggtac
caaactgagacacgccgtctctactctgtcctcgacaagcatctcgcatcggacaacagg
ccatacctgtgcggcacaaagtgcaccattgccgacattgctcactatggatggggagcg
gctgccggctgggcaggcgtcaacctggacaagttccctgcagttcaggcctggctggac
cgaatggaagcacgtgagggggtggagaaaggccgccacgtccccgatcctcacaccatg
agggagttgcttaaggacaaggctaagatggcggagcaggctgctaagagtcaggcgtgg
gtccaggccggcatgaaggaagacgccgagaagcaaaagtag

DBGET integrated database retrieval system