KEGG   Bipolaris sorokiniana: COCSADRAFT_79429Help
Entry
COCSADRAFT_79429  CDS       T03124                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc00052  Galactose metabolism
bsc00500  Starch and sucrose metabolism
bsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCSADRAFT_79429
   00500 Starch and sucrose metabolism
    COCSADRAFT_79429
Enzymes [BR:bsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     COCSADRAFT_79429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19140731
NCBI-ProteinID: XP_007695793
JGI: Cocsa1_79429
UniProt: M2T0N9
LinkDB All DBs
Position
Unknown
AA seq 911 aa AA seqDB search
MIRHILLGLAACSSFTNAAPLVHEATDLAATLTRRAEVDSCPGYTASNVVEKDSTLTADL
TLAGDACNAYSDDIKNLKLLVEYQNNERLHVKIYDADLQVFQVQEQVFPRPKHEKASTDS
TALQFDVKESPFSFTVKRRDGGEVLFDTETVPLVFEKQYVRLRTKLPDNPNIYGLGEHSD
SFRFHTDKYERVFLNGESINIPTNANLYGSHPVYFDHRGGKGTHGVFMLNSSPMQVDIKK
ADSGYQYLEYNTVGGVIDLYFMAGSKPAEVSKQYADVAGYSAMYPYWTLGFHQCKYGYWD
VNMVAEVVANYSTAGIPLEVMWTDIDYMHLREDFTTDPERFPLSKMRELVSTLHSRDQKY
VLILDPGVHAVGNYEPYEKGHEMEVFLKAADGTDLLGVQWPGEVAWPDWFAPNTQEWWTQ
EILKQFDADSGINLDGLWVDMNEASNFCQDPQTCNPRQKAIDDGIPPKPGNAPRPNTGRP
IPGFPASFQPSSGNSSKRQSASVIAPRQSANGSMKGFPDRNWFDPAYRVNSHLGKISQQT
IAMNTTNYDGTWQYDTHNLYGSMMASATHESMLARRPKVRPFVLSRSTFSGIGRKVAHWF
GDNASIWEHYRTSIRQMLSFVSMHQMPMVGSDVCGFNGNADQYMCARWAVLGAFQPFYRN
HAELSTIQQEFYQWPIVATAAKKAIETRYKLMDYIYTALYYQTQDGTPMINPLFFLYPED
EKTFDIQEQWFYGDALLISPVTVDYSDKVTFYLPNDVFYDYWTYGKVQGQGQNVTVSNLT
YSDIPVHIRGGSVIPHRVNSANTTKALRNEDFFVLVAPDAQGKAAGRLYLDDGESIEQAG
TSEINFSFDNGKFSATGSFGYKAQGAESIAVARVVVLGQAQEGATGEFDAKKQTIEVKGP
WTLNTEFGFEL
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgatacgccatattttgctcgggcttgccgcctgctcgagcttcaccaatgcggctcct
ctagtgcacgaggccactgacctcgctgccactctcacccgccgcgccgaagtggatagc
tgccctggctatactgcctcgaatgttgttgaaaaagattctactttgacggccgacctc
actctcgctggtgacgcctgcaatgcgtacagcgatgatattaagaatctaaagttgctc
gtcgagtaccaaaataatgagcgtctacacgtcaaaatttacgatgccgaccttcaggtt
ttccaagtccaagaacaagtcttccctcggccaaagcatgagaaggcatcaacggacagc
acagccctccaattcgacgttaaggaaagtcctttttcttttacagtaaagcgcagggat
ggcggtgaagttctttttgatactgaaaccgtccccctggtattcgagaaacagtacgtg
cgccttcggaccaagctccccgacaaccccaacatctacggcctcggtgagcacagcgat
tcattccgcttccacacggataagtatgagcgtgtgtttttgaacggcgagtctattaac
attcccaccaacgccaatctgtatggctctcacccagtgtattttgaccaccgtggtggc
aaaggtactcatggtgtctttatgctcaactcgagtcccatgcaagtggatattaaaaag
gccgacagcggttaccagtacctagagtataacaccgttggtggagtcatcgatttgtac
ttcatggctggcagcaagcccgccgaggtttccaagcaatacgctgacgttgccggctac
tctgcaatgtacccatactggactcttggtttccaccagtgcaagtacggatactgggac
gtcaacatggttgcggaagtcgttgccaactactccactgctggtattcctcttgaagtc
atgtggaccgatatcgactacatgcatcttcgcgaagacttcacaaccgatcctgaacgt
ttcccgctctcaaagatgcgtgaattggtatcaactcttcactcgcgcgatcagaagtac
gtactgatcttggatcctggggttcatgcagtcggcaactacgagccttacgagaagggc
cacgaaatggaggttttcctcaaggctgctgatggtactgatctccttggtgtccaatgg
cccggagaagtcgcatggcccgattggttcgcacccaacacccaggagtggtggacgcaa
gaaattctcaagcagttcgatgctgatagcggtattaatctcgacggactctgggtcgac
atgaacgaggcgtccaacttttgtcaggaccctcagacttgcaacccccggcaaaaggct
attgacgacggtattccaccaaagcctggaaatgctcctcgcccaaacactggtcgccct
attcctggcttcccagcgtcattccagccttcttccggtaatagctcaaagcgccaatcc
gctagtgtcattgctccacgtcaatctgccaacggcagcatgaagggtttcccagaccgc
aactggtttgaccctgcttaccgcgtcaacagccatctcggtaagatctcgcagcagacc
attgcaatgaacacgacaaactacgatggaacctggcagtacgacacgcacaacctgtac
ggcagcatgatggcttctgcgacccacgaatccatgctcgcccgccgtcccaaggtccgt
ccctttgtcctctcccgctccacattctcgggaattggccgcaaggtagcacattggttc
ggtgacaatgcctccatctgggagcactaccgcacctctatccgccagatgctgtccttc
gtctccatgcaccagatgcccatggtaggctccgacgtgtgcggcttcaacggcaacgca
gaccaatacatgtgcgcacgctgggccgtattgggcgccttccagcccttctaccgcaac
cacgccgaactcagcaccatccagcaagaattctaccaatggcccattgtcgccaccgcc
gcaaagaaggcaatcgaaacccgctacaaactcatggactacatctacaccgccctctac
taccaaacccaagacggcacgccaatgatcaatccgctcttcttcctctacccggaagac
gaaaagactttcgacatccaagaacaatggttctacggcgacgccctcctcatctcgccc
gtgacagtcgattactccgacaaagtcacgttctacctgcccaacgacgtcttctacgac
tactggacctacggcaaagtgcagggccagggccaaaacgtcacagtcagtaacctaacc
tacagcgacatccccgtgcatatccgcggcggaagcgtaatcccgcaccgtgtcaacagc
gcgaataccacaaaggcgctgcgcaacgaggactttttcgtgctcgtggccccagatgcg
caaggtaaagcggcggggcggttgtaccttgacgacggggagagcatcgaacaagccggc
actagcgagattaacttttcgtttgataatggcaagttcagtgctacagggtcgtttggg
tacaaggcacagggcgcggagagcatcgcagttgcgcgggtggtggtgctgggtcaggcg
caggagggcgcgacgggcgagtttgacgccaagaagcagactattgaggtcaaggggcca
tggaccttgaacacagagtttggctttgagctgtga

DBGET integrated database retrieval system