KEGG   Bipolaris sorokiniana: COCSADRAFT_87081Help
Entry
COCSADRAFT_87081  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bsc  Bipolaris sorokiniana
Pathway
bsc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    COCSADRAFT_87081
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     COCSADRAFT_87081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 19141159
NCBI-ProteinID: XP_007699005
JGI: Cocsa1_87081
UniProt: M2RGZ4
LinkDB All DBs
Position
Unknown
AA seq 217 aa AA seqDB search
MSAPQYTLPPLPYAYDALEPHISAQIMELHHSKHHQTYITNLNGLLRTQAEAVSTLDITS
QVSIQQGIKFNAGGHINHSLFWQNLAPASSNEAKSSAAPQLIKQIKATWGDEDRFKEAFN
TALLGIQGSGWGWLVKTEVGKEQRLSIVTTKDQDPVVGKGETPIFGVDMWEHAYYLQYQN
GKAAYVKNIWNVINWKTAEERYLGSRADAFSVLKASI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaccacagtacacgcttcctccgcttccctatgcatatgatgcattggagccg
cacatttctgctcagatcatggagctgcatcacagcaagcaccaccagacatatatcacc
aacctaaatggtcttctcaggacccaggctgaggctgtctcgaccctcgacatcacatct
caggtttcgatccagcaaggcatcaagttcaacgctggcggtcacatcaaccattccctc
ttctggcagaaccttgctccggccagctcaaacgaggctaagagctccgctgcgccccaa
cttatcaagcagatcaaggccacctggggtgatgaggacaggttcaaggaggccttcaac
actgctctactgggaatccagggtagcggttggggctggctcgtcaagactgaggttggc
aaggaacaacgactctctattgtgactacgaaagaccaggatcctgtagtcggcaagggc
gagactccaatttttggagtcgacatgtgggaacatgcgtactacttgcagtaccagaat
ggcaaagcagcctatgtgaagaacatctggaacgtgatcaactggaagacggccgaggaa
cggtacttgggatcgcgcgccgacgcattcagtgtgctcaaagcgtcgatctga

DBGET integrated database retrieval system