KEGG   Bipolaris sorokiniana: COCSADRAFT_88756Help
Entry
COCSADRAFT_88756  CDS       T03124                                 

Definition
(RefSeq) hypothetical protein
Organism
bsc  Bipolaris sorokiniana
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 3A FAD_binding_3 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 19141264
NCBI-ProteinID: XP_007699516
JGI: Cocsa1_88756
UniProt: M2RDY0
LinkDB All DBs
Position
Unknown
AA seq 361 aa AA seqDB search
MRAARYYGKEDIRIEDVEQQECGAGQVRIAPAYVGICGSDLHEYLGGPTFAPTEPHPCTK
DTIPITLGHEFSGIVTEVGSPDSAFSVGQNVCIQPSIYCGVCEACKAGCENVCFNGGFIG
LSGGGGGLSDSVVVPEAAVLHLPPNIPLDVGALVEPLSVAWHAVSAAPLSPDSTALILGG
GPIGLAIVQCLVAKGVGKIIVSEISGTRQRFAREFGAHHVLCPKTYDVVKMSKALSNGGP
DVVFDCAGVPASLTTACTAVRPKGTIVNVAIWETEVPFNPNLLVSREAKYTAVLGYRRED
FQAVLDLLASGKLKPSKMITRRIQLEDLVESGIKALVHDKENQVKILVEVGAMGRVDSAI
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgatattacggaaaagaggatattcggattgaggatgtggagcagcag
gagtgtggagcggggcaagtcagaattgccccggcctacgtaggcatctgcggttcggat
ctccatgagtatctcggtggacctacatttgcgccaacggagcctcacccatgcaccaaa
gacacgattcccattaccctcggccacgagttctcaggcatcgtcacagaagtgggatca
cccgactctgccttctccgtaggccaaaacgtctgtatccaaccaagcatatactgcgga
gtctgtgaagcatgcaaagcaggctgcgaaaacgtctgtttcaacggcggctttatcgga
ctatccggtggtggtggcggcctgagcgactccgtggtcgtacccgaagctgcagtcttg
catctaccacccaacattcctctcgatgtaggcgcgctggtcgagcccctgagcgtagcc
tggcatgccgtatccgccgcaccactgagtcccgattcgaccgcgttgatcctaggtggc
ggccccatcggcctcgccattgtccaatgtctcgtcgccaaaggcgtaggtaaaatcatc
gtaagcgaaatatccggcacccgccagcggtttgcacgagaattcggagcccatcatgtc
ttgtgtcccaagacgtacgacgttgtcaaaatgagcaaggcgctcagtaacgggggtcct
gatgtcgttttcgactgcgcgggcgtaccagccagtctcactactgcgtgcacagctgtg
cggcccaaaggcacgatagtcaatgtagcgatttgggagacagaagtgccatttaatccc
aacttgctggtttcgcgcgaagcaaagtatacggctgtgttagggtatcggagggaagat
tttcaagctgttctagatttgctggcttctggcaagttgaaaccgagtaagatgattacg
aggaggattcagttggaggatcttgtggagagtggcatcaaggctcttgttcatgacaag
gaaaaccaggtcaagattttggtcgaggttggggcgatggggcgggttgattctgctata
cattaa

DBGET integrated database retrieval system