KEGG   Blastococcus saxobsidens: BLASA_0118Help
Entry
BLASA_0118        CDS       T01752                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
bsd  Blastococcus saxobsidens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: CCG01117
UniProt: H6RK94
LinkDB All DBs
Position
complement(122398..123408)
Genome map
AA seq 336 aa AA seqDB search
MPLSVPGLPALPPELAGPVAVELAKPVRTIPPPGALTGGCRYEPKWDGYRLVIVRDRSST
RLWSKQGRDLTDRFPDVAAAALAQVPAGSVVDGEVVIWNGDRLDFGLLQRRMVTAAARIA
AQAAATPASYVAFDLLAAGGEDLRSRTLGRRRAVLEELADRWTPPLQLSPVTADPAEARQ
WFDDFRAAGVEGLVVKGAATRYAPGRREWLKVKSWESTEVLAGGVIGSLDRPSQLVAGRY
RDGELVVVGRTSPLSPGQAAELAAVLRPAAEDHPWPERIGTGRFGGGRLSVPLTRVEPSV
VVEVSADAALQAGVFRHPLRFVRTRPDLRAEDVPPV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctctccgtcccgggcctgcccgcgctgccaccggagctggccgggccggtcgcg
gtggagctggccaaaccggtgcgcaccatcccgccgccgggggccctgaccggtggctgc
cgctacgagcccaagtgggacggctaccgcctggttatcgtgcgggaccggagctccacc
cggctgtggtcgaagcagggccgggacctgaccgaccgcttccccgacgtcgcggccgcc
gccctcgcgcaggtgcccgcgggctcggtggtcgacggcgaggtcgtcatctggaacggc
gaccggctggacttcggcctgctgcagcgccgcatggtcaccgccgccgcgcggatcgcc
gcccaggccgccgccacccccgcctcctacgtcgcgttcgacctgctcgccgcgggcggc
gaggatctccggagccgcaccctcggccggcggcgcgccgtgctggaggagctggccgac
cgctggaccccaccgctgcagctctcgccggtgacggcggaccccgccgaggcgcggcag
tggttcgacgacttccgtgccgccggggtcgaggggctggtggtcaagggggcggccacc
cgctacgcccccggacggcgcgagtggctcaaggtgaagagctgggagagcaccgaggtg
ctcgccggcggcgtcatcggatccctcgaccggcccagccagctggtcgcgggccgctac
cgggacggcgagctggtcgtcgtcggccggaccagcccgctgtcccccgggcaggcggcc
gagctggccgccgtgctgcgccccgcggcggaggaccacccctggccggagcgcatcggc
acgggcaggttcggcggcgggcggctgtcggtgccgctcacccgcgtggagccctccgtc
gtggtcgaggtcagcgccgacgccgccctccaggccggtgtcttccggcacccgctccgg
ttcgtgcgcacccgccccgacctgcgcgccgaggacgtgccgccggtctga

DBGET integrated database retrieval system