KEGG   Blastococcus saxobsidens: BLASA_0675Help
Entry
BLASA_0675        CDS       T01752                                 

Definition
(GenBank) ABC-type multidrug transport system, ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsd  Blastococcus saxobsidens
Brite
KEGG Orthology (KO) [BR:bsd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsd02000]
    BLASA_0675
Transporters [BR:bsd02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BLASA_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 MukB AAA_23 DUF3584 SbcCD_C
Motif
Other DBs
NCBI-ProteinID: CCG01631
UniProt: H6RQV4
LinkDB All DBs
Position
652651..653565
Genome map
AA seq 304 aa AA seqDB search
MLEFDGLRKSYGADQVLDGVGFTVRPGSMFGFCGANGAGKTTTMRIAMGLVVPDAGEVRW
LGRPLDQQARRRVGYMPEERGLYPKMKVGEQVTYFARLHGLDAAAAARASAEWVERLGLG
ARKGDPVEKLSLGNQQRVQLAAALVSRPEVLILDEPFSGLDPVGVDSLAEALLDQVRTGV
PVVFSSHQLDLVERLCDSVGILARGRMVATGTVEELRRREAGRLLRVVAPDAAPGWATAL
PGVRVVSEQAGDTLLELAGDADDQAVLAAALRTGRVTHFAWRDPTLVELFRGAVADPGTD
EEAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgagttcgacgggctccgcaagagttacggcgccgaccaggtgctcgacggcgtt
ggcttcacggtccggccgggatcgatgttcggcttctgcggcgccaacggtgccggcaag
acgacgacgatgcggatcgccatgggcctcgtcgtgcccgacgccggggaggtccgctgg
ctgggccgaccgctggaccagcaggcgcgccgccgggtcggctacatgccggaggagcgc
gggctctacccgaagatgaaggtcggggagcaggtgacctacttcgcccggctgcacggg
ctggacgccgctgccgccgcgcgggcgtcggccgagtgggtggagcggctgggcctcggc
gcacggaagggcgatccggtcgagaagctgtcgctgggcaaccagcagcgcgtccagctg
gccgccgcgctggtcagccggcccgaggtgctcatcctcgacgagccgttctccggactc
gacccggtgggcgtcgactcgctggcggaggcgctgctggaccaggtgcgcaccggcgtc
ccggtcgtcttctccagccaccagctcgacctggtggagcggctctgcgactccgtcggc
atcctggcccgtggccgcatggtcgccaccgggacggtcgaggagctgcgccgccgggag
gccggccggctgctgcgggtggtcgccccggacgccgcccccggctgggccaccgcgctg
cccggtgtccgcgtggtctcggagcaggccggcgacacgctgctcgaactcgccggcgac
gccgacgaccaggcggtgctggccgcggcgctgcgcaccggccgggtcacccacttcgcc
tggcgggaccccaccctggtcgagctgttccgcggcgcggtcgccgacccgggcaccgac
gaggaggcggcgtga

DBGET integrated database retrieval system