KEGG   Blastococcus saxobsidens: BLASA_0679Help
Entry
BLASA_0679        CDS       T01752                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase, Carbon dioxide fixing enzyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00620  Pyruvate metabolism
bsd00680  Methane metabolism
bsd01100  Metabolic pathways
bsd01120  Microbial metabolism in diverse environments
bsd01200  Carbon metabolism
Module
bsd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLASA_0679 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    BLASA_0679 (ppc)
Enzymes [BR:bsd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BLASA_0679 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: CCG01635
UniProt: H6RQV8
LinkDB All DBs
Position
656784..659603
Genome map
AA seq 939 aa AA seqDB search
MSEATVDVADLRHHGSAGPGGRADDEPLREDIRLLGRILGEVIGEHAGPDVLELVESTRL
EAFGVRRSEVDRVALAARLDGLDVRSANHIIRAFSHFSVLANLAEDIHHERRRRHHRRAG
SPPQRGSLAATFELLDRAGLSEDTVARELAGALVCPVVTAHPTEVRRKTVFQVQRQIAEL
IRQRDRAGGGDVDDEWSARMSRSVLTLWQTALLRLSRLRLEDEIDEALRYYELSLFDVVP
AINADLRRAVEERWPGAGVLRRPMLLPGSWIGGDRDGNPFVTADALRRATTRQAETALGH
HLAELAELRSELSMSDRLITSTPELYALADASGDDSPFRADEPYRRALTGITARLAATAL
RVLGTVPGGRVAGPDVVAYAVPDELRADLDVVDASLRSHGAGALADDRLRRLREAVEVFG
FHLCGLDLRQNSAVHEEVVAELLAWAGVCEDYAALDEVARVELLAGELTLRRPLVRPDAQ
LSEGARKELDVLLAAAGQVALLGPRTIPNYVVSMCESVSDVLEVAVLLKEVGLLDPGGVD
GPTCPVGISPLFETIGDLQAAASTLGAVLDQPLYRSLLGNRGDVQEVMLGYSDSNKDGGY
LAANWALYRAELDLVEVARREGIRLRLFHGRGGTVGRGGGPSYEAVRAQPPGAVAGALRI
TEQGEVIAAKYADPDLARRNLEALVAATLESTLLDVEGLGQDADEAYALLDDLAARAQLA
YRELVHETPGFVEWFRAATPIGELAELNIGSRPPSRKAGDSIADLRAIPWVFSWSQTRIM
LPGWYGTGSALESFVDGSPERLERLRDLHRRWPFFRTILSNMGMVLAKTDLGLAARYAGL
VPDEELRARVFDRIREEHERTCRMTRAITGEDDLLADNPSLARSIRNRFPYLEPLHHLQV
EMLRRRRSAVSGEDPDDELTSRNIQLTINGIATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaagccaccgtcgacgtcgccgacctccgccaccacggatctgccggccccggc
ggccgcgccgacgacgagccgctgcgggaggacatccggctgctgggacgcatcctcggc
gaggtgatcggcgagcacgccgggcccgacgtcctggagctggtcgagtccacccggctg
gaggcgttcggagtccgccggtccgaggtcgaccgggtggcgctcgccgcccggctcgac
ggtctcgacgtccgctcggcgaaccacatcatccgggccttcagccacttctccgtgctg
gcgaacctggccgaggacatccaccacgagcgccgccggcggcaccaccggcgggcgggc
tccccgccgcagcgcggcagcctggcggccaccttcgagctgctggaccgggccggcctc
tccgaggacaccgtcgcccgcgagctggccggcgccctcgtctgcccggtggtcaccgcc
caccccaccgaggtgcgccgcaagaccgtcttccaggtgcagcgccagatcgccgagctg
atccggcaacgggaccgcgcagggggcggggacgtcgacgacgagtggtcggcgcggatg
tcgcgctcggtgctcaccctctggcagacggcgctgctgcggctgtcgcggctccggctc
gaggacgagatcgacgaggcgctgcgctactacgagctgtcgctgttcgacgtggtgccg
gccatcaacgccgacctgcgccgggcggtggaggagcggtggccgggggcaggggtgctg
cgccggccgatgctgctgcccggctcctggatcggcggtgaccgggacggcaacccgttc
gtcaccgcggacgcgctgcgccgggccaccacccggcaggcggagacggcgctgggccac
cacctggccgagctcgcggagctgcgcagcgagctgtccatgtccgaccggctgatcacc
tccaccccggagctctacgcgctggccgacgcctcgggcgacgactcgcccttccgcgcc
gacgagccctaccggcgggcgctgaccggcatcaccgcgcgtctggccgccaccgccctg
cgggtcctggggaccgtgcccggtggccgggtggccggtcccgacgtggtggcctacgcc
gtccccgacgagctgcgggccgacctcgacgtcgtcgacgcctcgctgcgcagccacggt
gccggcgcgctcgccgacgaccgcctgcggcggctgcgggaggcggtcgaggtcttcggg
ttccacctgtgcgggctggacctgcggcagaactcggcggtgcacgaggaggtggtcgcg
gagctgctcgcctgggcgggggtgtgcgaggactacgcggcactggacgaggtggcccgg
gtcgagctgctggccggggagctgacgctgcgccgtccgctggtgcggcccgacgcccag
ctctccgagggcgcccggaaggagctcgacgtcctgctcgccgccgccggccaggtggcc
ctgctggggccgcggaccatcccgaactacgtggtcagcatgtgcgagtcggtgagcgac
gtgctcgaggtcgccgtcctgctcaaggaggtcggcctgctcgacccgggcggcgtggac
ggccccacgtgcccggtcggcatctcgccgctgttcgagacgatcggcgacctccaggct
gctgcgagcaccctcggtgcggtgctcgaccagccgctgtaccggtcgctgctcgggaac
cggggcgacgtccaggaggtcatgctcggctactccgacagcaacaaggacggcggctac
ctggccgccaactgggcgctgtaccgggccgagctcgacctggtggaggtggcccgccgg
gagggcatccggctgcggctgttccacggtcgcggcggcaccgtcggtcgcggcggtggt
cccagctacgaggcggtccgggcccagccgcccggcgcggtggccggggcgctgcggatc
accgagcagggcgaggtgatcgcggccaagtacgccgatcccgatctcgcccgccgcaac
ctggaggcgctggtcgccgccaccctggagtcgacgctgctggacgtcgaggggctgggg
caggacgccgacgaggcctacgcgctgctcgacgacctcgccgcccgcgcgcagctggcc
taccgggagctggtccacgagacgcccgggttcgtcgagtggttccgggcggccaccccg
atcggggagctggccgagctcaacatcggcagccggccaccctcccgcaaggccggcgac
tcgatcgccgacctgcgggcgatcccgtgggtgttcagctggtcgcagacccggatcatg
ctgcccggctggtacggcaccggatcggcgctggagtcgttcgtcgacggatcgcccgaa
cggctggagcggctccgggacctgcaccggcgctggccgttcttccgcacgatcctgtcc
aacatgggcatggtgctggccaagaccgacctgggcctggccgcccggtacgccgggctg
gtgcccgacgaggagctgcgcgcccgcgtgttcgaccggatccgcgaggagcacgagcgc
acctgccggatgacgcgggcgatcaccggtgaggatgacctgctggccgacaacccctcg
ctggcccgctcgatccggaaccggttcccgtacctggagccgctgcaccacctgcaggtc
gagatgctgcggcgccgtcgcagtgccgtctctggcgaggaccccgacgacgagctgacc
agccggaacatccagctcaccatcaacggcatcgcgaccgcactgcgcaacagtggctga

DBGET integrated database retrieval system