KEGG   Blastococcus saxobsidens: BLASA_2512Help
Entry
BLASA_2512        CDS       T01752                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BLASA_2512
Enzymes [BR:bsd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BLASA_2512
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BLASA_2512
    1.1.1.-  
     BLASA_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2Fe-2S_Ferredox ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: CCG03392
UniProt: H6RWH7
LinkDB All DBs
Position
2403313..2404377
Genome map
AA seq 354 aa AA seqDB search
MRAARYYGKGDIRVEDVTEAQIREPDDVLIAPSYCGICGTDLHEYAVGPIVTPTTPHPLT
GVTNPQILGHEFSARVIEVGPAVRDVRPGDRVAIMPAIVCGRCRYCRRGQGHLCVQFACT
GLSAETGGMAELAVVKEYQVAMLPDEVSDLEGAVVEPAAVAAYGVERAGVTGGDVVLVTG
AGPIGVLTAMYAGAAGASSVIISEPNENRAALAARLDIGHVVDPTKGELADLVGELTHGD
GVDLAVECSGSSPGLASCVTLTRKRAAIVQTGLHTRPATLDAMALAEKDLTLYGSWCWNT
TDWPRIIRLIATGQYPVAKAVTTEIALDDVVPRGFDALIDPHGNELKVLVRAGS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgctgcccgctactacggcaagggcgacatccgagtcgaggacgtcaccgaggcg
cagatccgcgagcccgacgacgtcctcatcgcaccgtcctactgcggcatctgcgggacc
gatttgcacgagtacgcggtcgggccgatcgtcaccccgaccacgccgcacccgttgacc
ggtgtcacgaacccgcagatcctcggtcacgagttctcggcccgggtcatcgaggtcggt
ccggcggtccgggacgtgcggcccggagaccgggtcgcgatcatgccggccatcgtctgc
ggccggtgccggtactgccggcgcggccagggtcatctctgcgtgcagttcgcctgtacc
ggcctgagcgccgagaccggcgggatggccgagctcgcggtcgtcaaggagtaccaggtc
gcaatgctgcctgacgaggtgtccgacctcgagggcgccgtcgtcgagcccgcggccgtg
gctgcgtacggcgtcgagcgcgccggcgtcaccggtggcgacgtcgtgctcgtcacggga
gccgggccgatcggtgtgctgaccgcgatgtacgccggcgcggcgggcgcgtcctcggtg
atcatctcggagccgaacgagaaccgggcggcgctggccgcacggctcgacatcgggcac
gtcgtcgatccgaccaagggtgagctagcggacctggtcggcgaactgacccatggcgac
ggcgtcgacctggctgtggagtgctcgggcagctcaccgggactcgccagctgcgtgacg
ctgacccgcaagcgggcggcgatcgtgcagacgggcctgcacaccagaccggccaccctc
gacgcgatggcgttggccgagaaggacctgaccctctacggcagctggtgctggaacacc
accgactggccgcggatcatccggctcatcgccaccggccagtacccggtggccaaggcc
gtcacgaccgagatcgcgctcgacgacgtcgtgccccggggcttcgacgccctcatcgac
ccgcacggcaacgagctcaaggtgctcgtccgcgccggttcctga

DBGET integrated database retrieval system