KEGG   Blastococcus saxobsidens: BLASA_3261Help
Entry
BLASA_3261        CDS       T01752                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
bsd  Blastococcus saxobsidens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: CCG04129
UniProt: H6RR49
LinkDB All DBs
Position
3138483..3139544
Genome map
AA seq 353 aa AA seqDB search
MQPPAKPMLAKAVTTIPTGDEWFYEPKWDGFRCIVFRDGDEVELGSRNERPLTRYFPEVV
AAVREQLPERCVVDGEIVIARGDRLQFESLLQRIHPAESRITLLAEQTPASFVAFDLLAL
GTESLLEVPFDQRQERLRSVLAGAQPPVHVTAISRDADTAQRWFDTFEGAGLDGVVAKNG
QLPYGPDQRLMAKIKHVRTADCVVAGFRWHKSGPIVGSLLLGLYDDAGDLQHIGVAASFS
MKRRAELVEELAPYRAEALDGHQWRDWANAETGAGGEHRMPGAVSRWNAKKDLSWVPLRP
ELVVEIKYDQLEGRRLRHTGQFLRWRPDRDPRSCTYDQLDVPVRYDLAEVLDG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcagccgccggcgaagccgatgctcgccaaagccgtgaccacgatccccaccggcgac
gagtggttctacgagcccaagtgggacggcttccgctgcatcgtcttccgtgacggcgac
gaggtggagctgggcagccgcaacgagcggccgctgacccgctacttccccgaggtggtc
gccgcggtgcgggagcagctgcccgagcggtgcgtcgtcgacggcgagatcgtcatcgcc
cgcggcgaccggctgcagttcgagtcgctgctccagcgcatccatcccgccgagtcgcgg
atcaccctgctcgccgagcagacgccggcctcgttcgtcgccttcgacctgctcgcgctg
ggcaccgagtcgttgctcgaagtgccgttcgaccagcgccaggagcggctgcgcagcgtg
ctcgccggcgcacagccgccggtgcacgtgaccgccatcagccgtgacgccgacaccgcc
cagcgctggttcgatacgttcgagggcgccgggctcgacggcgtcgtcgccaagaacggg
cagctgccctacgggcccgaccagcggctgatggccaagatcaagcacgtgcggacggcg
gactgcgtcgtcgccgggttccgctggcacaagagcgggccgatcgtcggctcgctcctc
ctcggcctctacgacgacgccggcgatctgcagcacatcggggtcgccgcctccttctcg
atgaagcgccgcgccgaactggtcgaggagctggcgccctaccgcgcggaggcgctcgac
ggccaccagtggcgggactgggccaacgccgagaccggcgccggcggggagcaccgcatg
cccggagcggtgagccgctggaacgccaagaaggacctctcctgggtcccgctgcgcccg
gagctggtcgtggagatcaagtacgaccagctcgagggccgtcgacttcgtcacaccggc
cagttcctccgctggcgccccgaccgcgacccccgcagctgcacgtacgaccagctcgac
gtgccggtccgctacgacctggccgaggtgctggacggctga

DBGET integrated database retrieval system