KEGG   Blastococcus saxobsidens: BLASA_3812
Entry
BLASA_3812        CDS       T01752                                 

Gene name
coaD
Definition
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00770  Pantothenate and CoA biosynthesis
bsd01100  Metabolic pathways
bsd01240  Biosynthesis of cofactors
Module
bsd_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bsd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BLASA_3812 (coaD)
Enzymes [BR:bsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     BLASA_3812 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: CCG04647
UniProt: H6RWM6
LinkDB
Position
complement(3669486..3669971)
AA seq 161 aa
MRRAVCPGSFDPVTNGHVDVIGRAAGLYDELVVAVLVNPGKAGFFPVEERMDLLREAVAD
LPNVTVDSFQGLLVDYCRSHDIPVIVKGLRAVSDFEYELQMAQMNRELAGIETLFVPTAP
QVGHLSSSLVKQIATFGGDVSRLVPTVVHDRLAERARRDAQ
NT seq 486 nt   +upstreamnt  +downstreamnt
gtgaggcgtgccgtctgcccaggttccttcgatccggtcaccaacgggcacgtcgacgtc
atcggccgggctgccgggctctacgacgagctggtcgtcgccgtgctggtcaacccgggc
aaggccgggttcttcccggtcgaggagcgcatggacctcctccgcgaggccgtcgccgac
ctgcccaacgtcaccgtcgacagcttccaggggctgctcgtcgactactgccgcagccac
gacatcccggtgatcgtcaaggggctgcgggccgtcagcgacttcgagtacgagctccag
atggcccagatgaaccgggagctggccggcatcgagaccctgttcgtgcccaccgcgccg
caggtcggtcacctgtcctccagcctggtcaagcagatcgccaccttcggcggcgacgtc
tcccggctggtgcccacggtcgtccacgaccggctggccgagcgcgcccggcgggatgcg
cagtga

DBGET integrated database retrieval system