KEGG   Blastococcus saxobsidens: BLASA_3982Help
Entry
BLASA_3982        CDS       T01752                                 

Gene name
kgd
Definition
(GenBank) 2-oxoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00020  Citrate cycle (TCA cycle)
bsd00310  Lysine degradation
bsd00380  Tryptophan metabolism
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01120  Microbial metabolism in diverse environments
bsd01130  Biosynthesis of antibiotics
bsd01200  Carbon metabolism
Module
bsd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLASA_3982 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    BLASA_3982 (kgd)
   00380 Tryptophan metabolism
    BLASA_3982 (kgd)
Enzymes [BR:bsd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BLASA_3982 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: CCG04810
UniProt: H6RJ65
LinkDB All DBs
Position
3850234..3853998
Genome map
AA seq 1254 aa AA seqDB search
MSSVSSSRPSSASSPVAGFGTNEWLVEEMYQQFLADPSSVDQAWHEFFADYRPGSPVGGG
DRGEAPAGDGAPAAAPKQAAPKQAAPATPAPEAPAAAKKPDVPRPAAGSQPTGSSPVQKS
SQPAAKAAPKLPVADGSQSPLRGAAAAVVKNMNASLTVPTATSVRAVPAKLLADNRIVIN
NHLARARGGKISFTHLIGYALIRALEAFPNMNSAFAEVDGKPVLVQPEHVNFGLAIDLPK
PDGSRSLVVASIKGAEEMDFAGFWAAYEDIIRRARNNKLTMEDFSGTTISLTNPGTIGTN
HSVPRLTAGQGAIIGVGAMEYPAEFQGMSPEVLTEMGISKIITLTSTYDHRIIQGAESGD
FLRKLHALLLGEDGFYDEVFRSLRIPYEPVRWMPDVRVTREGQIDKEARVIEVIEAYRRN
GHLMADTDPLEFKVRTHPDLDILEHGLTLWDLDRRFPVGGFAGERLMPLRDILGVLRNSY
CRTVGVEYMHITDPEEREWLQQRIEVKHEQPDREKQKHILGRLNAAEAFETFLQTKYVGQ
KRFSLEGGESVIPILDEVLIAGTDHGLDEVAIGMAHRGRLNVLANVLGKSYAKIFGEFEG
NIDPGTVQGSGDVKYHLGATGRFRNPFQPDAEIAVSLASNPSHLETVNPVLEGIVRAKQD
MIDKGEEGFTVLPVLLHGDSAFAGQGVVQETLNLSQLRGYRTGGTVHVVINNQVGFTTSP
GSARSTLYSTDVARMVNAPIFHVNGDDPEACVRVARLAIEYRQKFKKDVVIDLVCYRRRG
HNEGDDPSMTQPQMYDIIDRKRSVRKLYTEALVGRGDITLEEAEEALKDYRGQLERAFAE
THDAQDSSKPEPVMDPRTPEQSQVKTAITPEVLKAIGDAHVSFPPDFTPHPKLQKMLERR
AAMASEGGIDWAMGELLAFGSLLMDGVPVRLAGQDSRRGTFVQRHSVLIDRENGDEYTPL
ANLTEEQAKFFVYDSLLSEYAAVGFEYGYSVANPQALVLWEAQFGDFVDGAQMVIDEFIS
SGEAKWGQRSGVVMLLPHGMEGQGPDHSSGRIERFLQLSAENNMTVANCTTPGNYFHLLR
RQALSDVHRPLVIFTPKSLLRAKAAVSPVSDFTEENFRPVLPDTGVGGEPLEASAVTRVL
LCSGKVAYDLMAQREADGRADTAVVRVEQLYPLPAEQIRAELERYPNASDVVWVQEEPAN
MGAWQFMAVNLPEELPADRKLRRVSRRASASPAVGSAKVHEVEQRTLVAEAFAD
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaagcgtgagttcatcccgaccgtcgtccgcctcgtccccggtcgccggtttcggc
accaacgagtggctggtcgaggagatgtaccagcagttcctcgccgacccgtccagcgtc
gatcaggcgtggcacgagttcttcgccgactaccggccgggcagtccggtcggtggcggc
gaccgaggcgaggcgccggccggtgacggcgcgcccgcggcggccccgaagcaggcggcc
ccgaagcaggcggccccggccactcccgcgccggaggcgcccgccgccgcgaagaagccc
gacgtcccgcgcccggccgccgggtcccagccgacggggagctcgcccgtgcagaagtcc
agccagcccgccgccaaggccgcgcccaagctcccggtcgcggacggcagccagtcgccg
ctgcgcggcgccgccgccgcggtggtcaagaacatgaacgcgtcgctgaccgtgccgacg
gcgaccagcgtgcgcgcggtgccggccaagctcctggccgacaaccgcatcgtcatcaac
aaccacctggcccgcgcgcgcggcggcaagatctcgttcacccacctgatcggttacgcg
ctgatccgggcgctcgaggcgttcccgaacatgaacagcgccttcgccgaggtcgacggc
aagccggtgctcgtgcagccggagcacgtcaacttcggcctggccatcgatctgccgaag
cccgacggctcccgctcgctggtggtggcctccatcaagggcgccgaggagatggacttc
gccggcttctgggccgcctacgaggacatcatccgccgggcccggaacaacaagctgacg
atggaggacttctccggcaccacgatcagcctgaccaacccgggcacgatcggcaccaac
cactcggtgccgcggctcaccgccggccagggcgcgatcatcggcgtgggggccatggag
tacccggccgagttccaggggatgagccccgaggtgctcaccgagatgggcatctcgaag
atcatcacgctgacctcgacctacgaccaccggatcatccagggcgcggagtccggcgac
ttcctgcggaagctgcacgcgctgctgctgggtgaggacggcttctacgacgaggtcttc
cgctccctgcgaatcccctacgagccggtgcgctggatgccggacgtgcgggtcacgcgc
gaggggcagatcgacaaggaagcccgcgtcatcgaggtcatcgaggcctaccggcgcaac
ggccacctgatggccgacaccgacccgctcgagttcaaggtccgcacccaccccgacctc
gacatcctcgagcacggcctgaccctgtgggacctggaccgccggttccccgtgggcggc
ttcgccggtgagcgactcatgccgctgcgcgacatcctcggcgtgctgcgcaactcctac
tgccgcacggtcggcgtggagtacatgcacatcaccgaccccgaggagcgcgagtggctc
cagcagcgcatcgaggtcaagcacgagcagcccgaccgggagaagcagaagcacatcctg
ggccggctcaacgccgccgaggcgttcgagacgttcctgcagacgaagtacgtcgggcag
aagcggttctccctcgagggcggcgagtcggtcatcccgatcctcgacgaggtgctcatc
gccggcaccgaccacggcctcgacgaggtcgcgatcggcatggcgcaccgcggccggctc
aacgtgctcgcgaacgtgctgggcaagagctacgcgaagatcttcggcgagttcgagggc
aacatcgatccgggcacggtccagggctccggtgacgtgaagtaccacctcggcgccacc
ggcaggttccgcaacccgttccagcccgacgccgagatcgccgtctcgctggccagcaac
ccgagccacctggagacggtgaatcccgtcctcgagggcatcgtgcgggccaagcaggac
atgatcgacaagggcgaggagggcttcaccgtcctcccggtcctgctgcacggtgactcc
gcgttcgccgggcagggcgtggtccaggagacgctgaacctctcccagctgcgcggttac
cgcaccggcggcacggtccacgtggtcatcaacaaccaggtcgggttcaccaccagcccc
ggctccgcgcgctcgacgctctactccaccgacgtcgcgcggatggtcaacgcgccgatc
ttccacgtcaacggcgacgaccccgaggcgtgcgtccgggtggcgcggctggcgatcgag
taccggcagaagttcaagaaggacgtcgtcatcgacctcgtctgctaccgccgccggggg
cacaacgagggcgacgacccctcgatgacccagccgcagatgtacgacatcatcgaccgc
aagcgctcggtccggaagctctacaccgaggcgctggtcggccgcggcgacatcaccctc
gaggaggccgaggaggcactcaaggactaccgcggtcagctcgagcgggcgttcgccgag
acccacgacgcgcaggactcctcgaagcccgagccggtcatggacccgcgcaccccggag
cagtcgcaggtgaagaccgcgatcacccccgaggtgctcaaagccatcggcgacgcgcac
gtctccttcccgccggacttcaccccgcacccgaagctgcagaagatgctcgagcgtcgc
gcggcgatggccagcgagggcggcatcgactgggcgatgggcgagctgctggccttcgga
tcgctgctcatggacggcgtccccgtgcgcctggcgggccaggactcgcgccgcggcacg
ttcgtgcagcgccactcggtgctcatcgaccgggagaacggcgatgagtacaccccgctg
gccaacctcaccgaggagcaggcgaagttcttcgtctacgactcgttgctgtccgagtac
gccgcagtcggcttcgagtacggctactcggtggccaacccccaggcgctggtgctctgg
gaggcgcagttcggcgacttcgtcgacggggcgcagatggtcatcgacgagttcatcagc
tccggcgaggccaagtggggccagcgctccggcgtcgtcatgctcctgccgcacggcatg
gaggggcagggccccgaccactccagcggccggatcgagcggttcctgcagctgtcggcc
gagaacaacatgacggtcgccaactgcacgacgcccggcaactacttccacctgctccgc
cgccaggcgctgtcggacgtgcaccggccgctggtcatcttcacgccgaagtcgctgctg
cgggccaaggccgcggtcagccccgtcagcgacttcaccgaggagaacttccgcccggtg
ctgcccgacaccggcgtcggcggcgagcccctcgaggcatccgcggtcacgcgggtgctg
ctgtgcagcggcaaggtcgcctacgacctgatggcgcagcgggaggccgacggccgcgcc
gacaccgccgtggtgcgggtcgagcagctgtacccgctgccggccgagcagattcgtgcg
gagctcgagcgctacccgaacgcctccgacgtcgtctgggtgcaggaggagccggccaac
atgggggcctggcagttcatggcggtcaacctgcccgaggagctgccggccgaccggaag
ctgcggcgggtcagccgccgggcgtcggccagcccggccgtgggctcggcgaaggtgcac
gaggtcgagcagcgcacgctggtcgccgaggccttcgccgactga

DBGET integrated database retrieval system