KEGG   Blastococcus saxobsidens: BLASA_3991Help
Entry
BLASA_3991        CDS       T01752                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase [Ni]
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
bsd  Blastococcus saxobsidens
Brite
KEGG Orthology (KO) [BR:bsd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BLASA_3991 (sodN)
Enzymes [BR:bsd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BLASA_3991 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: CCG04819
UniProt: H6RJ74
LinkDB All DBs
Position
3861432..3861836
Genome map
AA seq 134 aa AA seqDB search
MRLTRMFSAVEATAHCDLPCGVYDPAQARIEAESVKGIQEKYQANDDPVFRTRAIMIKEQ
RAELVKHHLWVLWTDYFKPPHFEKYPQLHELFNKATKQAGAAGGKGSMDPAEGQKLLDYI
AEIDKIFWETKAAA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcacccgcatgttctccgccgtggaggccaccgcgcactgcgacctcccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggcggaatccgtcaagggcatccaggag
aagtaccaggccaacgatgacccggtcttccgcacccgcgccatcatgatcaaggagcag
cgggcggagctggtcaagcaccacctgtgggtgctgtggaccgactacttcaagccgccg
cacttcgagaagtacccgcagctgcacgagctgttcaacaaggccaccaagcaggccggc
gcggccggcggcaagggcagcatggaccccgccgagggccagaagctgctcgactacatc
gccgagatcgacaagatcttctgggagacgaaggccgccgcctga

DBGET integrated database retrieval system