KEGG   Blastococcus saxobsidens: BLASA_4208Help
Entry
BLASA_4208        CDS       T01752                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase [NADP] (Oxalosuccinate decarboxylase) (IDH) (NADP(+)-specific ICDH) (IDP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00020  Citrate cycle (TCA cycle)
bsd00480  Glutathione metabolism
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01120  Microbial metabolism in diverse environments
bsd01130  Biosynthesis of antibiotics
bsd01200  Carbon metabolism
bsd01210  2-Oxocarboxylic acid metabolism
bsd01230  Biosynthesis of amino acids
Module
bsd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLASA_4208 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BLASA_4208 (icd)
Enzymes [BR:bsd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BLASA_4208 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: CCG05033
UniProt: H6RLV4
LinkDB All DBs
Position
complement(4079929..4081143)
Genome map
AA seq 404 aa AA seqDB search
MAKIKVEGTVVELDGDEMTRIIWQFIKDQLILPYLDVNLEYYDLGIEARDATDDQITVDS
ANAIKKHGVGVKCATITPDEARVEEFGLKRMYRSPNGTIRNILGGVIFREPIIMENVPRL
VPGWTKPIVVGRHAFGDQYRATDFKFPGEGTLTITFTPKDGSEPIEHEVFQSPGGGVAMA
MYNLDDSIRDFARASMNYGLQREYPVYLSTKNTILKAYDGRFKDLFEEVFQAEFKEKFDA
AGITYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMSPDGR
TVEAEAAHGTVTRHFRQHQQGKETSTNPIASIFAWTRGLAHRGKLDNTPEVTRFAETLEK
VCIDTVESGQMTKDLALLISKDQPWLTTQDFLAAIDTNLQKAMA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagatcaaggtcgagggcaccgtcgtcgaactcgacggcgacgagatgacccgg
atcatctggcagttcatcaaggaccagctgatcctcccgtacctcgacgtgaacctggag
tactacgacctgggcatcgaggccagggacgcgaccgacgaccagatcacggtcgactcc
gcgaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgaccatcacgccggacgag
gcgcgcgtcgaggagttcggcctcaagcggatgtaccgctcgcccaacgggacgatccgc
aacatcctcggcggcgtcatcttccgcgagccgatcatcatggagaacgtgccgcggctg
gtgcccggctggaccaagccgatcgtcgtcggccggcacgccttcggtgaccagtaccgc
gccaccgacttcaagttccccggtgaggggaccctgacgatcaccttcacgccgaaggac
ggctccgagccgatcgagcacgaggtcttccagtcgccgggtggcggcgtcgcgatggcg
atgtacaacctcgacgactcgatccgtgacttcgcccgcgcctcgatgaactacggcctg
cagcgcgaatacccggtctacctctccacgaagaacacgatcctcaaggcctacgacggc
cggttcaaggatctgttcgaggaggtgttccaggcggagttcaaggagaagttcgacgcc
gccggcatcacctacgagcaccggctcatcgacgacatggtcgccgcgtccctcaagtgg
gagggcggctacgtgtgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtc
gcccagggcttcggctcgctcggcctcatgacgtcggtgctcatgagccccgacggccgc
acggtcgaggccgaggccgcgcacggcacggtgacccgccacttccgccagcaccagcag
ggcaaggagacgtcgaccaacccgatcgcctccatcttcgcctggacccggggtctggcc
caccgcggcaagctggacaacacccccgaggtgacccgcttcgccgagaccctggagaag
gtctgcatcgacaccgtcgagagcggccagatgaccaaggacctcgcgctgctgatctcc
aaggaccagccgtggctgaccacccaggacttcctggcggccatcgacaccaacctgcag
aaggccatggcctga

DBGET integrated database retrieval system