KEGG   Bacillus selenitireducens: Bsel_0388Help
Entry
Bsel_0388         CDS       T01243                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bse  Bacillus selenitireducens
Brite
KEGG Orthology (KO) [BR:bse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bsel_0388
Enzymes [BR:bse01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bsel_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 HI0933_like GIDA DAO FAD_binding_3 AlaDh_PNT_C FAD_oxidored Thi4 Glutaredoxin NAD_binding_8 NAD_binding_7 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ADH97928
UniProt: D6XX71
LinkDB All DBs
Position
complement(405189..406739)
Genome map
AA seq 516 aa AA seqDB search
MVLDNAITQQLKQYLDLLEGDLTFKLDAGSDANSDKLAGFVREVASMSPRITVEEASLAR
TPSFTVTRTGENTGVTFAGVPLGHEFTSFVLAILQVSGRPPKVEEETLNQMKQLEGDFTF
ETYVSLSCQNCPEVVQALNMLSAVNPGVTNTMIDGAAFKDEVEARDVMAVPAVYLNGEFL
GGGRMTIEDILEKLGQGTDASELDAKDPFDVLVVGGGPAGASAAVYASRKGIRTGVVAER
FGGQVQDTMSIENFISVKKTEGPKLVASLEEHVRDYSVDIMKSQRVKAVDKKDLFEVTLE
NGAVLKSKSVILSTGARWRNVGVPGEEAFKNNGVAYCPHCDGPLFEGKDVSVIGGGNSGV
EAAIDLAGIVNHVYLLEFMPELKADEVLQKKLHSLPNVTVITNAQTTEITGDKKVNGISY
KDRVTEEDRHIPLQGVFVQIGLVPNTEFLDDSIETTRMGEIVVDQHGATNVPGLFAAGDC
TNTPYKQIIISMGSGATASLGAFDYLIRSEEPVVSV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtactcgacaacgccattactcaacagctgaaacagtatctcgacctcctcgaaggg
gacttgacgttcaagcttgacgcaggcagcgacgccaattcagacaaactcgcgggcttt
gtccgtgaggtggcgtcgatgtcgccacgcattaccgtcgaagaagcaagccttgcgcgt
acgccaagctttaccgtcacacggacgggcgagaacaccggcgtcaccttcgccggcgtt
cccctcggacacgagttcacatcgtttgtccttgcgatcctccaggtaagcggacggccg
ccgaaagtggaggaggaaacactcaatcaaatgaaacagcttgaaggcgactttacgttt
gagacgtacgtcagcctcagctgccaaaactgtccggaagtcgttcaggctctgaatatg
ctcagtgccgtcaacccaggcgtcacgaacaccatgatcgacggcgccgcatttaaagac
gaagtggaagcccgtgacgtcatggccgtacccgccgtctatctgaacggtgaattctta
ggcggcggacgcatgaccatcgaagacatccttgaaaagctcggtcaagggaccgatgcc
tccgaactcgacgcaaaagatccgttcgatgtcctcgtcgtcggcggcggtcccgcaggc
gcgagtgcggccgtgtacgcctcaagaaaagggatccgcaccggagttgtcgccgagcgt
tttggcggacaggtgcaggatacgatgagcatcgagaacttcatcagtgtcaaaaagacc
gaaggaccgaagcttgtcgcgagccttgaagagcacgtccgtgattacagcgtggatatc
atgaagagccagcgcgtcaaagccgttgataagaaggatctctttgaggtcacccttgag
aacggcgcagtccttaaaagcaaaagcgtcatcctctccaccggtgcccgctggcgaaac
gtcggggttccgggtgaagaagcattcaaaaataacggtgtcgcttactgcccgcactgt
gacggcccgctctttgaaggcaaagacgtctccgtcatcggcggcggcaactcgggtgtg
gaagccgccattgacctggccgggatcgtcaatcacgtatacctgcttgagttcatgccg
gaactgaaggctgatgaagtcctgcaaaagaaactccacagcctgcctaatgtcactgtc
attacgaatgcacagacgacagaaatcacaggtgataaaaaagtgaacggcatttcctac
aaagaccgtgtcacagaagaagaccggcacattccccttcagggcgtgttcgtgcagatc
ggacttgtgccgaacaccgagtttctcgatgattccatcgagacgacccgcatgggcgaa
atcgtcgtcgatcagcacggcgcaaccaacgtcccggggctgtttgctgcaggagactgc
accaataccccctataaacagatcattatctcgatgggctccggagcgaccgcttccctc
ggcgcgttcgattatttaatccgctcagaggaacctgtcgtatctgtataa

DBGET integrated database retrieval system