KEGG   Bacillus selenitireducens: Bsel_1004Help
Entry
Bsel_1004         CDS       T01243                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bse  Bacillus selenitireducens
Pathway
bse00620  Pyruvate metabolism
bse00680  Methane metabolism
bse01100  Metabolic pathways
bse01120  Microbial metabolism in diverse environments
bse01200  Carbon metabolism
Module
bse_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bsel_1004
  09102 Energy metabolism
   00680 Methane metabolism
    Bsel_1004
Enzymes [BR:bse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bsel_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ADH98525
UniProt: D6Y0D4
LinkDB All DBs
Position
1165716..1168484
Genome map
AA seq 922 aa AA seqDB search
MAPLNEQDPNMMLRSDVNKLGKILGDVLRHHGGEALFNEVEEIREMTKALRKSYDEANEK
ELKKRIENLKSPMRQQVIRAFAIYFHLVNIAEQHHRIRRSRQYRMKRGENIQPSSIEAAI
VNIQKEKYPETVIQQVLDDSSIELIMTAHPTEATKRTILEIQKRISYILEQFDNPALTEK
EREDHEESLINEVTALWHTDELRFKKPTVIDEVKNGLYYFDTTLFDVLPAVHQEIEEQLE
RYYPDQDFKVPNFIHFGSWIGGDRDGNPFVTPEVTWETLNLQRDLTLRKYEESITELMRR
FSQSTTRVDIDPEFIETMEQYEKKYMKKSETWPVTTEIYRRMLGAIRKRIRQVGKTNTGY
DVAEELLADLRYVRENALKHQLPNQKLKQLNKMIRQVELFGFHLATLDVRNHSGEHETAI
AEILKVVGITEDYKSLDEEEKMTILENALKDPRPLMLLNEDYSEETREIFKVFQMIKDAH
EEFGQRSIEVYLVSMTQSASDLLEVLVLAKEAGIYRLHADGSVDSNLHVAPLLETVDDLM
AGPAIMKRLFEMDIYRTHLGERGDHQEIMLGYSDGSKDGGTLTANWKLFEAQAKIHNMAK
DYNVRLKFFHGRGGSLGRGGGPLNRSIVSQPAETLGDGVKITEQGEVLSSRYLLGDIAFR
NLEQAASALLEASANVYASPGDSCHIRRPQWEEAMEEISKASLSKYQSLVFKDPDFLTYF
KETTPLNELKELNIGSRPMSRKGSERFEDLRAIPWVFAWTQCRQMLPAWYASGTGLAAYG
KASEENLELLQDMYQNWPFFHSTINNLQMALMKADLFAAKEYVKLVKDQEMGQRIYGEIE
KEFNLTKEMLLKISGSEQLLDFTPNIRDSVHLRNPYVDPLNFLQVDLIEKMRESSSEERT
EELLTEVLLTISGVAAGLLNTG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggcaccattaaatgaacaagatccgaacatgatgctgagaagtgacgtcaacaaactg
gggaagatccttggtgacgtgctgaggcaccatggcggggaagcgctctttaatgaagtg
gaagagattcgtgaaatgaccaaggcccttcgtaaatcctatgatgaggccaacgagaaa
gaactgaaaaagcgcattgaaaatctgaaatcgccgatgcgccaacaggtcatccgtgca
ttcgccatctattttcacctggtgaatattgcagaacagcatcaccggatccgccgctcc
aggcagtaccggatgaagcgtggtgagaatattcagccaagctccattgaggcggcgatc
gtgaatattcaaaaggaaaagtatccggaaacggtgatccagcaggtgcttgatgattcg
tccatcgaactcatcatgactgcacacccgactgaggcgacgaagcggacgatcctggag
attcaaaagcgcatttcctatatccttgagcaatttgacaacccggctctgacagagaaa
gagcgggaagatcatgaagagagtctgattaatgaagtcactgcactctggcacaccgat
gaacttcgtttcaaaaaaccgacggtcattgatgaagtgaaaaacggcctgtattatttt
gatacgacgcttttcgatgtgctgcctgcggtgcatcaggagattgaggaacagctcgag
cggtactatccggatcaggacttcaaggttccgaactttattcactttggttcgtggatc
ggcggagaccgtgacgggaacccgtttgtcacccctgaagtcacgtgggagacgttgaac
ctgcagcgtgatctgaccctccgtaaatacgaggagagcatcacggaactgatgcgccgg
ttcagccagtccaccacccgtgtggatatcgatccggaatttattgaaacgatggaacaa
tacgagaagaagtatatgaagaaatccgaaacgtggccggtgacaacggaaatttaccga
cggatgctcggtgccataagaaaacggatccgtcaggtcggcaagacgaatacgggctat
gatgtggcggaagaactccttgcagatctccgttatgtacgcgagaacgcattgaagcat
cagctgccgaaccagaagctcaagcagctgaacaaaatgatccgtcaggttgaactgttc
ggcttccatttggccaccctcgatgtccgaaaccacagcggcgagcatgagacggccatc
gcggagattctgaaagtcgttggcattaccgaggattacaagtcgcttgatgaagaagag
aagatgacgattcttgagaacgccctgaaggatccgcgaccgttgatgctcttaaatgaa
gattattccgaagagacaagagagatcttcaaagtgttccaaatgatcaaagatgcccat
gaggagttcgggcagcgctccattgaagtgtatctcgtcagcatgacgcagtccgcgtcc
gacctccttgaggtgctggtgcttgcaaaagaagcgggaatttaccgtctgcatgccgac
ggctccgtcgacagtaaccttcacgtggcgccgctccttgagacggttgatgacctcatg
gcaggtcctgcaatcatgaaacgtctgtttgaaatggatatttaccgcacgcatctcggt
gagcgcggggatcatcaggaaatcatgctcggctattcggacggcagtaaagacgggggt
acacttaccgccaactggaagctgtttgaagcccaggcgaagattcataatatggcgaag
gactataatgtccgcctgaagttcttccacggacggggcggatcactcggacggggcggc
ggtccattgaaccgcagtatcgtctcacagccggcggaaacgctcggtgacggggtcaag
atcaccgaacagggcgaggtgctctcatcgcgttatctcttgggtgacattgcctttcgg
aacctcgaacaggcggcatcagcccttcttgaggcctctgcgaatgtgtacgcgtctcct
ggggacagctgccacatccggcgcccgcagtgggaagaagcgatggaggagatctccaaa
gcctcgttatccaagtatcaatccctcgtcttcaaggacccggatttcctgacgtacttc
aaggaaacgacgccgttgaatgaactgaaggaactgaacatcggaagccgtccgatgagc
cgtaagggcagtgagcggtttgaagacctccgggcgatcccgtgggtgtttgcttggacc
cagtgccgtcagatgctgccggcgtggtacgcgtccggtacgggactcgcggcctacggc
aaggcgagtgaagagaaccttgaactgctgcaggatatgtatcagaactggccgttcttc
cactcgacgattaataatctgcaaatggcgctcatgaaagcggacctgtttgcagcgaag
gaatatgtgaagctcgtgaaggatcaggagatgggacagcggatttacggcgagattgaa
aaagaattcaatctcaccaaggagatgcttttgaagatttccggcagtgaacagctcctc
gacttcacaccgaatatccgggactccgttcatctgcggaatccgtatgtcgatccgctt
aacttccttcaggtcgatctgatcgagaagatgcgcgagtcctcatcagaggaacggacc
gaagaactgcttacggaagtgctcctcacaatcagtggtgtagctgcagggttgttaaat
acaggttga

DBGET integrated database retrieval system