KEGG   Bacillus selenitireducens: Bsel_2564Help
Entry
Bsel_2564         CDS       T01243                                 

Definition
(GenBank) iron-sulfur cluster binding protein
  KO
K18979  epoxyqueuosine reductase [EC:1.17.99.6]
Organism
bse  Bacillus selenitireducens
Brite
KEGG Orthology (KO) [BR:bse00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bse03016]
    Bsel_2564
Enzymes [BR:bse01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.6  epoxyqueuosine reductase
     Bsel_2564
Transfer RNA biogenesis [BR:bse03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Bsel_2564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1730 Fer4_16 HEAT_2 Fer4_9 Fer4_10 HEAT_PBS Fer4_6 Fer4 HEAT Fer4_7 Fer4_21 HEAT_EZ Fer4_2 Arm Fer4_17 DUF1924 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADI00065
UniProt: D6XXM2
LinkDB All DBs
Position
complement(2789285..2790478)
Genome map
AA seq 397 aa AA seqDB search
MNRQMLKQRMIEYSKEIGIDKIGFASADPFVTLKERLRRSSDAGYASGFEEGTLEERTEP
ERLLPAAKTIVSIAMAYPSKMKNPPRSVKGERRGIFCRASWGEDYHHVLRRKLQELERFV
QACDPDIRTALMVDTGALSDRAVAERAGIGWSAKNCAVITPEFGSYVYLGEMIMTVDLEP
DQPLEDQCGSCTACIDACPTGALVQGGQLNAQRCIAYLTQTKGVLPKEFRKKIGNRLYGC
DTCQTVCPENKGKHTDHHKEMQPDPEKVKPKLIPLLQMSNRQFKETYGSMAGSWRGKKPI
QRNALIGLANFKDESALPEIEKVLHGDPRPEIRATAAWALAEIAGASARERLINQLSHDE
SEIVQEEIHDIMKHLPTANRLVKQEHEKGGLASDAEK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacaaatgttaaaacagcgtatgattgaatacagcaaggaaatcggtattgat
aaaatcggatttgcctccgcagacccgttcgtgacgttgaaagaacggctcaggaggagc
agtgatgcaggctatgcgtccggttttgaagaagggacgcttgaagagcggaccgaaccc
gagaggctgttgcctgcggcgaagacaattgtgtcgattgccatggcatatccgtcaaag
atgaaaaatccgccgcgctctgtaaaaggagaacggcgaggcatcttttgcagggcatcc
tggggagaagattatcatcatgtgctccggagaaagcttcaggaacttgaacgctttgtt
caggcatgcgatccggatatcaggacggcactgatggttgatacaggcgcactgtcggac
cgggctgtggctgagcgggcggggattggctggagtgcgaagaactgcgcggtgattact
cctgaattcggctcttacgtgtatctcggtgagatgatcatgaccgttgaccttgaaccg
gatcagccccttgaagaccagtgcgggtcgtgtacagcctgcatcgatgcctgtccaacc
ggtgccctggtgcagggcggtcaactgaatgcgcagcgctgcatagcctacctgacgcag
acaaaaggtgtattgccaaaagaattccgcaaaaaaatcgggaatcgcctgtacggctgt
gacacgtgtcagaccgtctgtccggagaataaaggcaagcacacggatcatcacaaagag
atgcagcccgatccggagaaggtgaagccgaaactgatcccgctcctgcaaatgtcgaac
cggcagttcaaggagacgtacggaagtatggccgggtcctggcgggggaaaaagccaatt
cagcgcaatgcgctcataggccttgccaacttcaaagatgaatcggcgcttccggaaatt
gagaaagtgctgcatggggatccccgtccggaaatccgtgccacagcggcatgggcgctg
gcagaaattgcgggcgcttccgccagggaacgcttgatcaatcagctctcgcatgacgaa
tctgagattgtacaagaagaaattcacgatatcatgaaacatttgcccactgccaatcgt
ctagtaaagcaggaacacgaaaaaggaggacttgcttcagatgccgaaaaatag

DBGET integrated database retrieval system