KEGG   Bacillus selenitireducens: Bsel_3266Help
Entry
Bsel_3266         CDS       T01243                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bse  Bacillus selenitireducens
Pathway
bse00500  Starch and sucrose metabolism
bse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bsel_3266
Enzymes [BR:bse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bsel_3266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: ADI00748
UniProt: D6Y1G1
LinkDB All DBs
Position
3527758..3529251
Genome map
AA seq 497 aa AA seqDB search
MNRNHTMLQFFEWHVPNHGKHWEDLAIMAHEFSVHGIDTVWIPPACKGMTQADNGYGVYD
HFDLGEFDQKGTVRTKYGTRKELLHAMDVCRKENIQVIADVVMNHKAGADDTEHFEVVEV
DPENRHEVISEPFEIEGWTRFNFKGRKKQYSPFQWDYHHFNGTDYDASEDRTGIFRILGD
GKDWNDHVDDEFGNYDYLMFANIDYQHPNVQEEMIHWGTWFAKTLGCQGYRLDAIKHINA
AYVSRFVHAMKESFGEDFYFVGEFWNPDLEAKQRFLDQTDFTIHLFDVALHYRFHQASIE
GRDFDLRTLYEGTLVATHPTHAVTFVDNHDSQPGESLESWVGDWFKPLAYALILLREDGF
PCVFFGDYFGIRGDDPIPSKKELIDPLLDARYYLAYGEQEDYFDHANTVGWVRHGVESFD
GSGCAVVISTGDDGFKDMKVRDTHAGSTWIDVTGNRDDEVVIEEDGTGRFPVNGGSVSVW
ALKSYGLKRKEAVEERR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaatcacacgatgcttcaatttttcgaatggcatgtaccgaaccacggcaag
cattgggaagacctcgccatcatggctcacgaattcagcgttcacggcattgataccgtc
tggatcccgccggcgtgcaagggcatgacccaggcagataacggttacggggtctatgac
cactttgacctcggcgaatttgatcaaaaaggcacggtccgaacaaagtacggcactcga
aaagagctccttcatgccatggatgtatgccgaaaggaaaacattcaggtcatcgccgat
gttgtgatgaatcataaagccggcgctgatgacacggaacatttcgaagtggttgaagtc
gatcccgagaaccgccatgaggtgatcagtgagccgtttgaaatcgaaggctggacacgt
tttaattttaaaggaagaaagaagcagtattccccgtttcaatgggattaccatcatttc
aacggaacggattatgatgcttccgaagaccgaaccggcatctttcggatcctcggcgac
gggaaggactggaacgaccacgttgatgatgaatttggcaattacgactacctgatgttc
gccaatattgattatcagcacccgaatgtccaggaggagatgattcactgggggacctgg
tttgccaaaaccctcggatgccaaggttaccggctcgatgccattaaacacatcaatgcc
gcctacgtctcccgtttcgttcatgccatgaaagagtcattcggtgaggacttctatttt
gtcggggagttttggaatccggatcttgaagcgaagcagcgctttctcgatcaaacggac
ttcaccattcatctcttcgatgtcgcccttcactaccgtttccatcaggcgtccatcgag
ggccgtgattttgatttacggaccctttacgaaggaacacttgttgccacacacccgacg
catgccgttacgtttgtcgacaaccatgattcccagcccggggagtctctggaatcctgg
gtgggagactggtttaagcccctcgcctacgccctgatccttcttcgtgaggatggattt
ccgtgcgtgtttttcggggattatttcggcattcgcggtgacgatccgatcccatccaaa
aaagaactcatcgatccgctcctcgatgcccgttactacctcgcctacggcgagcaggag
gattacttcgatcatgccaacaccgtcggctgggtccggcacggtgtggaatcgttcgat
ggctccggatgcgccgtcgtgatctccacaggcgacgacgggtttaaggatatgaaggtc
cgtgacacacatgccggcagcacctggattgatgtcaccggaaaccgtgacgatgaagtg
gtcattgaagaggatgggacaggacgctttcccgtcaatggcgggagcgtctccgtctgg
gcactgaaatcttatggcctcaaacggaaagaagctgtcgaagaaagacgttga

DBGET integrated database retrieval system