KEGG   Bradymonas sediminis: DN745_05840Help
Entry
DN745_05840       CDS       T05497                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bsed  Bradymonas sediminis
Pathway
bsed00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DN745_05840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsed02000]
    DN745_05840
Enzymes [BR:bsed01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DN745_05840
Transporters [BR:bsed02000]
 Other Transporters
  Pores ion channels [TC:1]
   DN745_05840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: AWV88884
LinkDB All DBs
Position
1571237..1571911
Genome map
AA seq 224 aa AA seqDB search
MTTADLTLYYAPRTRAFTALWLLEELGEDYVLESFDLSTGRHKQPDYLALNPMGKVPMVV
DRGRAVPEIGAIAIYLADLYAEGGLAPGADDPKRPDYLRWIFFASAIIEPALGEKLFGWT
PAPSSLAWGSFDEMVRVATDGVSQGDWLLGETFSAADILVGAGLRFGMMFGALPTDGPIA
DYVARCTSREAFKRALAIDEREGERFSPQASSEVEAGEDDGGNS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgccgatctgaccctttattatgccccgcgaacccgcgccttcaccgctctt
tggctgctcgaagaactcggcgaagactacgtgttggagagttttgacctgtcgacgggc
cggcataagcagccggattatctcgcgcttaatccgatgggaaaggttccgatggtggtc
gaccggggcagggcggtgcccgagatcggcgctatcgcgatctacctggccgacctctat
gcggagggcgggttggcgcctggggcggatgacccgaagcgcccggattatttgcgctgg
atcttctttgcgagcgcgataattgagccagcgctcggcgaaaaactattcggttggaca
ccggcaccttcgagcctcgcctggggatcgtttgatgagatggtgcgcgtcgcgaccgac
ggtgtttcgcagggagattggctgctcggcgagacgttcagcgcggcggatatcctggtc
ggcgcgggccttcgctttgggatgatgttcggggcgctgcccacggacggacctatcgcc
gattatgtcgcgcgttgcacgagtcgcgaggcgttcaagagggcgttggcgattgacgag
cgcgagggggagcgattctcgccacaggcgtcgtcggaggttgaggcgggcgaggatgac
ggcgggaattcgtaa

DBGET integrated database retrieval system