KEGG   Bradymonas sediminis: DN745_11010Help
Entry
DN745_11010       CDS       T05497                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bsed  Bradymonas sediminis
Pathway
bsed00970  Aminoacyl-tRNA biosynthesis
bsed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DN745_11010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsed03029]
    DN745_11010
Enzymes [BR:bsed01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DN745_11010
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DN745_11010
Mitochondrial biogenesis [BR:bsed03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DN745_11010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AWV89839
UniProt: A0A2Z4FLI3
LinkDB All DBs
Position
complement(2935514..2937037)
Genome map
AA seq 507 aa AA seqDB search
MSQKISEEIRQRYEVVIGLEVHVQLRTETKIFSGASAAYGAAPNTQVSPLDLGLPGVLPV
LNMRAVEFAMKAGFALNCEVREWSRFARKNYFYPDMPKGYQITQFEHPICEFGHLEVAVD
PAGLAPGADAPQGAEATKKVRILRIHMEEDAGKSTHVEGQPYSLVDLNRAGVPLIEIVSE
PDIRSASEAVDYLKKLRNIVVYLGISDGNMQEGSFRCDANVSVRPWGQEALGTRSELKNI
NSFKFVHDAIDFEVNRQIAMLESGEKVVQETRLYNPDKGETFSMRSKEESHDYRYFPEPD
LPPLVIDSAWMERVKTTLPELPEARRARYLGELGLSEYDAGVLTDDFLLSEYFNEAVAAC
PKDAKPSLYKSVANWIINELLARLDGETGLADVKVRPPQLARLVQLIDEDAISGKIGKKV
FDEMLASGAEPDAIIEAKGLKQISDSGALGEIIDQLIAENPEPVADYRAGNNNIVGWFVG
QVMKATRGQANPKVVNKLLVEKLRGDA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaaaatatctgaagaaattcgtcagcgctacgaggtcgtcattggccttgag
gtgcatgttcaattgcgcaccgagaccaagattttcagcggggcgtcggccgcctatggc
gccgcgccgaatacccaggtctcgccgctggacctcgggctgccgggcgtcttgccggtc
ctgaatatgcgggcggttgagttcgcgatgaaggccggtttcgcgctcaattgcgaggtg
cgcgagtggagccgcttcgcgcgcaaaaattatttctatcccgatatgcccaagggctat
cagatcacgcaattcgagcacccgatctgcgagttcgggcacctcgaggtcgcggtcgac
ccggccgggcttgcccccggcgccgacgcgccccagggcgccgaggccaccaaaaaggtg
cgcatcctgcgcattcatatggaggaggacgccggtaaatcgacccacgtcgagggccag
ccctatagcctggtcgaccttaaccgcgcgggcgtcccgctcatcgagattgtcagtgag
cccgatattcgctcggctagcgaggcggtcgattacctcaaaaagctgcgaaatatcgtg
gtctacctggggatttcggacggcaatatgcaggagggatcgtttcgctgcgacgccaac
gtctcggtgcgcccctggggccaggaggcgttgggcacccgcagtgagctcaagaatatc
aactcctttaaattcgttcacgacgccatcgacttcgaggtgaaccgccagatcgccatg
ctcgaatcgggcgaaaaggtcgtccaagaaacacgtctttataacccggataagggcgag
acgttttcgatgcgcagcaaggaagagtcccacgattatcgctatttccccgagccggat
ctgccgcccttggtcattgattcggcgtggatggagcgggtcaagacgaccttgcccgag
ctgcccgaagcgcggcgcgcgcgctacctcggcgagcttggcttgagcgaatatgacgcc
ggtgtgctgaccgacgattttctgctctcggagtattttaatgaggctgtcgccgcgtgt
cccaaagacgccaaacccagcctctataagtccgtcgccaattggatcatcaacgaattg
ctcgcccgcttggacggcgagacggggcttgctgatgtgaaggttcgcccgccccagctt
gcgcgacttgtgcaattgatcgacgaggacgcgatcagcggaaagatcggcaaaaaggtc
ttcgacgagatgctcgcgagcggagcagagcccgacgcgatcatcgaagcgaagggcctg
aagcagatttcagatagcggcgcgcttggtgagattatcgaccaattaatcgctgagaat
cccgaacccgtcgcggactatcgcgccgggaataacaatatcgtcggatggtttgtcggt
caggttatgaaggccacgcgcggccaggcgaacccgaaggtggtcaataaattgctcgtt
gagaagctacgaggtgatgcatga

DBGET integrated database retrieval system