KEGG   Bradymonas sediminis: DN745_13890Help
Entry
DN745_13890       CDS       T05497                                 

Definition
(GenBank) hypothetical protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsed  Bradymonas sediminis
Pathway
bsed00020  Citrate cycle (TCA cycle)
bsed00190  Oxidative phosphorylation
bsed00650  Butanoate metabolism
bsed01100  Metabolic pathways
bsed01110  Biosynthesis of secondary metabolites
bsed01120  Microbial metabolism in diverse environments
bsed01130  Biosynthesis of antibiotics
bsed01200  Carbon metabolism
Module
bsed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DN745_13890
   00650 Butanoate metabolism
    DN745_13890
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DN745_13890
Enzymes [BR:bsed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DN745_13890
    1.3.5.4  fumarate reductase (quinol)
     DN745_13890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_8 Fer4_7 Fer4_17 Fer4_10 Fer4_9 Fer4 Fer4_6 Fer4_4 Fer4_3 Fer4_18 Fer4_2 Fer4_16 Fer4_21 Fer4_15 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AWV90361
UniProt: A0A2Z4FMZ6
LinkDB All DBs
Position
complement(3690471..3690794)
Genome map
AA seq 107 aa AA seqDB search
MNRVALLCALTCIGCGACVAACPNSSASLFTSAKLTQFAKLPQGQPERDIRTIRMVTTMD
DEGFGNCSNIGECEAVCPKGISINNISRMRRDYVRAVLRTGGRVTES
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgcgtggccttattatgtgcgcttacctgcatcggctgcggcgcctgcgtcgcc
gcgtgcccgaactcctcggcctcgctcttcaccagcgcgaagctcacgcaatttgcgaag
ctcccgcagggccagcccgagcgcgacatccgcaccatccgcatggtcaccaccatggac
gacgagggcttcggcaactgctccaatatcggcgagtgtgaggctgtgtgccccaaaggc
atcagcatcaacaatatctcgcggatgcgccgcgattatgtgcgcgcggtgctccgcacc
ggcgggcgcgtcaccgagtcctga

DBGET integrated database retrieval system