KEGG   Bradymonas sediminis: DN745_13905Help
Entry
DN745_13905       CDS       T05497                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsed  Bradymonas sediminis
Pathway
bsed00020  Citrate cycle (TCA cycle)
bsed00190  Oxidative phosphorylation
bsed00650  Butanoate metabolism
bsed01100  Metabolic pathways
bsed01110  Biosynthesis of secondary metabolites
bsed01120  Microbial metabolism in diverse environments
bsed01130  Biosynthesis of antibiotics
bsed01200  Carbon metabolism
Module
bsed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DN745_13905
   00650 Butanoate metabolism
    DN745_13905
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DN745_13905
Enzymes [BR:bsed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DN745_13905
    1.3.5.4  fumarate reductase (quinol)
     DN745_13905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO GIDA Pyr_redox_2 NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AWV90363
UniProt: A0A2Z4FN50
LinkDB All DBs
Position
complement(3694180..3696132)
Genome map
AA seq 650 aa AA seqDB search
MTKLESKVPEGPLHEKWDNRKHHYGLVSPNNKKKHTIIVVGTGLAGASSAASLAEMGYKV
KNFCISDSPRRAHSIAAQGGINANKNYPNDGDSTWGLFYDTIKGGDYRSREANTYRLAQL
SSNIIDQAVAQGVPFAREYGGELATRSFGGALVSRTFYARGQTGQQLLLGAYGALMRQVD
GGNCEMFAHREMLDLVMVDGRARGIITRNLFTGALERHAADAVVLCTGGYGRAYFLSTNA
VNSNATAAWRCHKRGALMANPSYVQIHPTCIPASTEYQSKRTLMSESLRNDGRIWVPKNK
EDVGKPPNSIPPEDRDYYLERKYPAFGNLVPRDVASRNAHYMVKQGYGVGPLRNAVYLDF
STAIKEKGKAAIEAKYGNLFDMYQKITDENPYEQPMRIFPAVHYVMGGLWVDYDLMSNLP
GLFVAGEANFSDHGANRLGASALMQGLADGYFIVPASVSNYLATERFNLTPVKDDQAEFK
AVEKDVRANIDELLKLNELALKKPAEERRTVIDIYSELGKILWDDVGIERTAEGLEHALE
AIPRLREEFYSGVLIPGSDDTFNKYLEIAGRVADFLEVGELMARDALDRDESCGCHFRAD
HQTPKGEALRNDEDFAYVAAWEYKGRGEKPVLHKEELEFEFVELKQRSYE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagttggaatcgaaagtcccagaaggtccgcttcacgagaagtgggataaccgc
aagcaccattacgggctggtttcccccaataataagaaaaagcacaccattattgtggtc
ggaaccggtctggcgggggcgtcctcggcggcctcgctggcggagatgggctataaggtt
aagaacttttgcatctcggattcgccccggcgtgcgcactccatcgcggctcagggcggt
atcaacgccaataaaaactaccccaacgacggtgacagcacctggggtcttttttatgac
acgatcaaaggcggcgactatcgctcgcgcgaggccaacacctaccggctcgcccagctt
agctcgaatatcatcgaccaggcggtcgcccagggcgtgccgttcgcgcgtgagtacggc
ggcgagctggcgacgcgctccttcggtggcgcgctggtttcgcgaaccttctatgcacgc
ggccagacgggccagcaattgctgctgggcgcctacggcgcgctgatgcgccaggtcgac
ggcggcaattgtgagatgttcgctcaccgcgagatgctggacctggtgatggtcgacggg
cgcgcccgcggcatcatcacgcgcaacctcttcaccggcgcgctggagcgccacgccgct
gacgccgtggtcctttgcaccggcggttatggtcgcgcgtacttcctgtcgaccaacgcg
gtgaactcgaacgcgaccgccgcctggcgctgccacaagcgcggcgcgctgatggcgaac
ccgtcctacgtccagattcacccgacctgcatcccggcctcgaccgagtatcagtccaag
cgcacgctcatgagtgagagtctgcgaaacgacggacgcatctgggtgcccaagaataaa
gaggacgtcggcaagccgccgaactcgatcccgcccgaagaccgcgactattatctggag
cgcaaataccccgccttcggaaacctggtgccgcgcgacgtggcctcgcgtaacgcccat
tatatggtcaagcagggttacggtgtcggcccgctgcgaaacgctgtctatctggacttc
tccacggcgatcaaagagaagggcaaagccgcgattgaggccaaatacggcaacctcttc
gatatgtaccagaagatcaccgacgagaatccctatgagcagccgatgcgcatcttcccg
gcggttcactatgtgatgggtggtctgtgggttgactacgacctgatgagcaacctgccc
gggctcttcgtggccggcgaggcgaacttcagcgaccacggcgccaaccgcctgggcgcg
agcgcgctgatgcagggtctggccgacggctatttcattgtgccggcttcggtcagcaac
tacctggccaccgagcgcttcaacctcacgccggtcaaagacgaccaggccgagttcaag
gcggtcgagaaagacgtgcgcgccaatatcgacgagctgcttaagctcaacgagctggcg
ctcaaaaagcccgccgaagagcggcgcaccgtcatcgacatctatagcgaactcggcaaa
atcctgtgggatgacgtgggcattgagcgcaccgccgaaggcctggagcacgctcttgag
gcgatcccgaggctgcgcgaggagttctactccggcgtgctgatcccgggctccgacgat
accttcaataagtacctcgagatcgccgggcgcgtcgctgacttcctggaagtcggtgag
ctgatggcgcgcgacgcgctggaccgcgatgagtcctgcggttgtcatttccgcgccgac
caccagacccccaagggcgaggcgctgcgaaacgacgaggacttcgcgtacgtcgcggcc
tgggagtataagggacgcggcgagaagccagttttgcacaaagaagaattggaattcgaa
tttgtggaactgaagcagcgtagctacgaataa

DBGET integrated database retrieval system